Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3D8R5V8

Protein Details
Accession A0A3D8R5V8    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MTSRTERFERKPRSPQKNEEPVEVHydrophilic
NLS Segment(s)
PositionSequence
156-163RGKALMRR
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
Amino Acid Sequences MTSRTERFERKPRSPQKNEEPVEVIRFSPEEEASLLSESNAQKTSANELFVKSEYKDAIDVYGQALSTCPNYLDYEIAVLKSNVAACHLKLEDWKEAIKAATAAIDGLDKLKEKGEEGEKPQEEEEADEEIISAGAAKAEDVSVKGQREKDIERIRGKALMRRARARSEQGGWASLSGAEEDYKLLEKMDNLSAADRKLVRQQLLKLPPRTKAAQEKEMGDMMGKLKDLGNGILKPFGLSTENFNMVKDEKTGGYSMNFNQGGPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.88
3 0.88
4 0.89
5 0.82
6 0.76
7 0.7
8 0.62
9 0.57
10 0.48
11 0.37
12 0.28
13 0.26
14 0.22
15 0.2
16 0.18
17 0.14
18 0.14
19 0.15
20 0.14
21 0.14
22 0.13
23 0.1
24 0.16
25 0.15
26 0.18
27 0.18
28 0.17
29 0.18
30 0.19
31 0.26
32 0.23
33 0.25
34 0.23
35 0.23
36 0.25
37 0.25
38 0.26
39 0.19
40 0.2
41 0.18
42 0.18
43 0.17
44 0.15
45 0.15
46 0.13
47 0.13
48 0.11
49 0.11
50 0.1
51 0.09
52 0.09
53 0.08
54 0.08
55 0.08
56 0.08
57 0.08
58 0.1
59 0.11
60 0.11
61 0.1
62 0.12
63 0.12
64 0.12
65 0.11
66 0.1
67 0.09
68 0.1
69 0.11
70 0.08
71 0.11
72 0.11
73 0.1
74 0.15
75 0.15
76 0.14
77 0.16
78 0.2
79 0.19
80 0.2
81 0.21
82 0.17
83 0.18
84 0.17
85 0.15
86 0.11
87 0.08
88 0.07
89 0.06
90 0.06
91 0.05
92 0.05
93 0.05
94 0.05
95 0.06
96 0.06
97 0.06
98 0.08
99 0.08
100 0.09
101 0.13
102 0.17
103 0.2
104 0.24
105 0.32
106 0.31
107 0.31
108 0.31
109 0.27
110 0.23
111 0.19
112 0.16
113 0.1
114 0.09
115 0.08
116 0.08
117 0.07
118 0.07
119 0.05
120 0.04
121 0.02
122 0.03
123 0.03
124 0.03
125 0.03
126 0.03
127 0.03
128 0.04
129 0.06
130 0.09
131 0.11
132 0.14
133 0.15
134 0.17
135 0.2
136 0.22
137 0.29
138 0.34
139 0.4
140 0.4
141 0.41
142 0.4
143 0.42
144 0.4
145 0.36
146 0.37
147 0.38
148 0.4
149 0.45
150 0.47
151 0.48
152 0.51
153 0.52
154 0.47
155 0.42
156 0.42
157 0.35
158 0.33
159 0.28
160 0.24
161 0.19
162 0.15
163 0.12
164 0.08
165 0.07
166 0.06
167 0.06
168 0.06
169 0.06
170 0.07
171 0.07
172 0.07
173 0.08
174 0.08
175 0.11
176 0.13
177 0.13
178 0.12
179 0.15
180 0.16
181 0.16
182 0.19
183 0.17
184 0.16
185 0.22
186 0.27
187 0.28
188 0.31
189 0.36
190 0.42
191 0.51
192 0.57
193 0.59
194 0.57
195 0.58
196 0.59
197 0.57
198 0.54
199 0.55
200 0.54
201 0.53
202 0.53
203 0.5
204 0.48
205 0.46
206 0.39
207 0.29
208 0.24
209 0.18
210 0.16
211 0.14
212 0.12
213 0.12
214 0.14
215 0.15
216 0.16
217 0.2
218 0.2
219 0.21
220 0.22
221 0.21
222 0.2
223 0.18
224 0.17
225 0.14
226 0.13
227 0.18
228 0.22
229 0.27
230 0.27
231 0.27
232 0.28
233 0.28
234 0.28
235 0.24
236 0.21
237 0.17
238 0.19
239 0.2
240 0.19
241 0.19
242 0.22
243 0.22
244 0.28
245 0.28