Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8N393

Protein Details
Accession B8N393    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-70MVDNNFKKKLRREERHKKRKERKKEKEKEKEKEKEKEKEKEKEKEKEKEKEKERKMNKKRKKGAIFTSAKBasic
NLS Segment(s)
PositionSequence
7-63KKKLRREERHKKRKERKKEKEKEKEKEKEKEKEKEKEKEKEKEKEKERKMNKKRKKG
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MVDNNFKKKLRREERHKKRKERKKEKEKEKEKEKEKEKEKEKEKEKEKEKEKERKMNKKRKKGAIFTSAKDWVSGPVEVKHLLRSSARQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.93
3 0.95
4 0.95
5 0.94
6 0.94
7 0.95
8 0.95
9 0.95
10 0.95
11 0.95
12 0.95
13 0.95
14 0.95
15 0.94
16 0.93
17 0.91
18 0.88
19 0.87
20 0.84
21 0.82
22 0.8
23 0.8
24 0.78
25 0.78
26 0.78
27 0.78
28 0.78
29 0.78
30 0.78
31 0.78
32 0.78
33 0.78
34 0.78
35 0.78
36 0.78
37 0.79
38 0.79
39 0.79
40 0.8
41 0.82
42 0.84
43 0.86
44 0.87
45 0.88
46 0.89
47 0.9
48 0.89
49 0.86
50 0.83
51 0.83
52 0.78
53 0.69
54 0.65
55 0.59
56 0.5
57 0.42
58 0.34
59 0.27
60 0.24
61 0.23
62 0.2
63 0.18
64 0.21
65 0.22
66 0.23
67 0.24
68 0.23
69 0.25