Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8N410

Protein Details
Accession B8N410    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
192-214AKISRSQQDKLRKLRRKAQVVVDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 13.5, cyto 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR025845  Thg1_C_dom  
IPR024956  tRNAHis_GuaTrfase_cat  
IPR007537  tRNAHis_GuaTrfase_Thg1  
IPR038469  tRNAHis_GuaTrfase_Thg1_sf  
Gene Ontology GO:0005525  F:GTP binding  
GO:0042802  F:identical protein binding  
GO:0000287  F:magnesium ion binding  
GO:0008193  F:tRNA guanylyltransferase activity  
GO:0006400  P:tRNA modification  
Pfam View protein in Pfam  
PF04446  Thg1  
PF14413  Thg1C  
Amino Acid Sequences MNAAAVEVMKDLPDLCIAYGVSDEYSFVFHPSCQLFERRSAKLVTTIVSTFTAHYVYLWGTYFPDNPLQFPYLPSFDGRAVMYPATRNLRDYMSWRQVDCHINNLYNTTFWTMVLQGGMSNTDAEQELKGTVSSDKNEILFKRFGINYNNEEEIYKKGSVLYRQYQLEDIKPKSESKSGVLAEEEGNNVQEAKISRSQQDKLRKLRRKAQVVVDHVDIIKDEFWERRPWILSGKPGKLPTEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.11
4 0.1
5 0.11
6 0.11
7 0.11
8 0.1
9 0.09
10 0.09
11 0.07
12 0.09
13 0.09
14 0.1
15 0.1
16 0.09
17 0.15
18 0.16
19 0.18
20 0.19
21 0.24
22 0.24
23 0.33
24 0.39
25 0.36
26 0.38
27 0.37
28 0.36
29 0.36
30 0.35
31 0.27
32 0.24
33 0.22
34 0.21
35 0.2
36 0.19
37 0.15
38 0.14
39 0.13
40 0.1
41 0.1
42 0.09
43 0.08
44 0.09
45 0.09
46 0.09
47 0.1
48 0.11
49 0.12
50 0.13
51 0.19
52 0.18
53 0.18
54 0.21
55 0.22
56 0.2
57 0.21
58 0.23
59 0.18
60 0.18
61 0.18
62 0.17
63 0.15
64 0.17
65 0.15
66 0.13
67 0.12
68 0.12
69 0.12
70 0.11
71 0.15
72 0.18
73 0.18
74 0.19
75 0.19
76 0.2
77 0.21
78 0.24
79 0.28
80 0.31
81 0.33
82 0.31
83 0.32
84 0.35
85 0.39
86 0.35
87 0.33
88 0.27
89 0.26
90 0.26
91 0.27
92 0.22
93 0.16
94 0.16
95 0.12
96 0.1
97 0.09
98 0.09
99 0.08
100 0.08
101 0.07
102 0.07
103 0.05
104 0.05
105 0.05
106 0.05
107 0.04
108 0.04
109 0.05
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.06
118 0.08
119 0.09
120 0.1
121 0.11
122 0.12
123 0.13
124 0.16
125 0.16
126 0.17
127 0.16
128 0.16
129 0.18
130 0.19
131 0.21
132 0.22
133 0.26
134 0.25
135 0.27
136 0.28
137 0.24
138 0.23
139 0.21
140 0.19
141 0.19
142 0.16
143 0.13
144 0.14
145 0.17
146 0.21
147 0.26
148 0.29
149 0.3
150 0.31
151 0.32
152 0.34
153 0.33
154 0.34
155 0.35
156 0.32
157 0.29
158 0.3
159 0.31
160 0.31
161 0.33
162 0.3
163 0.25
164 0.31
165 0.28
166 0.28
167 0.26
168 0.25
169 0.21
170 0.2
171 0.18
172 0.12
173 0.11
174 0.1
175 0.1
176 0.08
177 0.1
178 0.1
179 0.15
180 0.21
181 0.22
182 0.27
183 0.33
184 0.38
185 0.43
186 0.53
187 0.56
188 0.61
189 0.7
190 0.75
191 0.77
192 0.83
193 0.84
194 0.83
195 0.8
196 0.8
197 0.78
198 0.74
199 0.7
200 0.62
201 0.53
202 0.44
203 0.38
204 0.28
205 0.2
206 0.15
207 0.12
208 0.13
209 0.14
210 0.17
211 0.24
212 0.26
213 0.3
214 0.32
215 0.33
216 0.38
217 0.4
218 0.47
219 0.49
220 0.53
221 0.54
222 0.55