Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3D8SEU0

Protein Details
Accession A0A3D8SEU0   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
51-74LAFLCLARRRRRRRATNYTTNPTPHydrophilic
NLS Segment(s)
PositionSequence
58-64RRRRRRR
Subcellular Location(s) extr 8, mito 7, plas 7, E.R. 2, nucl 1, cyto 1, cyto_nucl 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR020999  Chitin_synth_reg_RCR  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDIIKRALIDKRAICRTGYPYYRTYTCSSWSRWGRWVLAGILILFALIFILAFLCLARRRRRRRATNYTTNPTPMVANTATAPAYGYNNGPQQEYGQMNGAYGANPPYQQGYNPPPGPPPNTYGGYKAPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.44
3 0.46
4 0.48
5 0.47
6 0.43
7 0.4
8 0.44
9 0.45
10 0.44
11 0.41
12 0.35
13 0.35
14 0.36
15 0.36
16 0.41
17 0.44
18 0.44
19 0.45
20 0.46
21 0.42
22 0.39
23 0.38
24 0.28
25 0.24
26 0.21
27 0.16
28 0.12
29 0.1
30 0.08
31 0.05
32 0.05
33 0.03
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.04
42 0.08
43 0.14
44 0.24
45 0.34
46 0.43
47 0.54
48 0.65
49 0.73
50 0.8
51 0.85
52 0.85
53 0.86
54 0.85
55 0.81
56 0.71
57 0.62
58 0.52
59 0.41
60 0.32
61 0.21
62 0.17
63 0.11
64 0.11
65 0.09
66 0.1
67 0.1
68 0.09
69 0.09
70 0.07
71 0.08
72 0.08
73 0.09
74 0.11
75 0.15
76 0.16
77 0.16
78 0.16
79 0.16
80 0.2
81 0.2
82 0.18
83 0.18
84 0.17
85 0.16
86 0.17
87 0.16
88 0.11
89 0.11
90 0.13
91 0.1
92 0.11
93 0.11
94 0.13
95 0.14
96 0.15
97 0.21
98 0.25
99 0.33
100 0.35
101 0.35
102 0.38
103 0.42
104 0.46
105 0.42
106 0.39
107 0.36
108 0.38
109 0.39
110 0.37