Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3D8SFC8

Protein Details
Accession A0A3D8SFC8    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MANRKATKAKNQRAKQRSQKRQQELTTGHydrophilic
43-69EPPTAANLKKRKKRKSKTGNQPLNLRSHydrophilic
NLS Segment(s)
PositionSequence
50-60LKKRKKRKSKT
Subcellular Location(s) nucl 20.5, mito_nucl 12.5, mito 3.5
Family & Domain DBs
Amino Acid Sequences MANRKATKAKNQRAKQRSQKRQQELTTGSNVVRSVDTTSPPPEPPTAANLKKRKKRKSKTGNQPLNLRSGKPPMEMTLVQRLEAIFPWLGLVINMIRHFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.87
3 0.87
4 0.88
5 0.88
6 0.9
7 0.88
8 0.89
9 0.81
10 0.79
11 0.72
12 0.65
13 0.58
14 0.49
15 0.39
16 0.32
17 0.29
18 0.21
19 0.16
20 0.13
21 0.13
22 0.13
23 0.14
24 0.15
25 0.17
26 0.18
27 0.19
28 0.19
29 0.17
30 0.16
31 0.16
32 0.18
33 0.23
34 0.26
35 0.34
36 0.41
37 0.49
38 0.56
39 0.65
40 0.71
41 0.75
42 0.8
43 0.82
44 0.85
45 0.87
46 0.91
47 0.92
48 0.91
49 0.85
50 0.82
51 0.72
52 0.69
53 0.59
54 0.5
55 0.41
56 0.38
57 0.35
58 0.3
59 0.29
60 0.23
61 0.27
62 0.26
63 0.27
64 0.31
65 0.3
66 0.28
67 0.27
68 0.25
69 0.21
70 0.21
71 0.2
72 0.1
73 0.1
74 0.1
75 0.1
76 0.1
77 0.08
78 0.1
79 0.08
80 0.12