Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3D8RGA8

Protein Details
Accession A0A3D8RGA8    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
365-400MEAISVKRQRKLKMKKHKYKKLMRRTRNLRRRLDRNBasic
NLS Segment(s)
PositionSequence
108-131EKKTAPAGEKKSPARSSRRKTAGK
371-400KRQRKLKMKKHKYKKLMRRTRNLRRRLDRN
Subcellular Location(s) mito 19.5, mito_nucl 13, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MFSSSVRRVAFNAPQAPIVSSISSTAPRATASKALSHRSHQRRCSSSKPSNPADGSRGISHGQSVPPGSVQAKSETEETKSTEFSHSKAAEGSKATGDAANGERANAEKKTAPAGEKKSPARSSRRKTAGKPDMKDELFGNLPSVPSTTYINANQISVASFFSLHRPISITTAIPKQVSTEQFESIFKPRSNAKTSDVIGTLMNTIDGLGRRAHDPTNAGDHSKWMSEADPLRVEVSVEPSQNGAVQHLDQAPGIEFPFTQNFLTGKYRPFQPPPPPQPMNTADSLAAGAEAAESLEPQQKTYTAVLTIEESTDLNGEVTYSAHSSPFVENETVIPTRFLDRMRLRQERFEESREQKLKSDDGGMEAISVKRQRKLKMKKHKYKKLMRRTRNLRRRLDRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.41
3 0.39
4 0.35
5 0.29
6 0.22
7 0.16
8 0.16
9 0.17
10 0.18
11 0.18
12 0.17
13 0.16
14 0.16
15 0.18
16 0.19
17 0.23
18 0.23
19 0.3
20 0.33
21 0.4
22 0.42
23 0.48
24 0.55
25 0.6
26 0.67
27 0.68
28 0.72
29 0.73
30 0.76
31 0.79
32 0.78
33 0.78
34 0.78
35 0.78
36 0.74
37 0.74
38 0.7
39 0.64
40 0.58
41 0.52
42 0.46
43 0.38
44 0.36
45 0.28
46 0.26
47 0.24
48 0.23
49 0.2
50 0.19
51 0.19
52 0.17
53 0.16
54 0.19
55 0.18
56 0.17
57 0.17
58 0.19
59 0.2
60 0.21
61 0.24
62 0.23
63 0.25
64 0.25
65 0.27
66 0.25
67 0.24
68 0.25
69 0.28
70 0.27
71 0.25
72 0.31
73 0.29
74 0.27
75 0.29
76 0.29
77 0.25
78 0.26
79 0.26
80 0.18
81 0.18
82 0.18
83 0.15
84 0.14
85 0.14
86 0.13
87 0.16
88 0.15
89 0.15
90 0.15
91 0.15
92 0.19
93 0.16
94 0.17
95 0.14
96 0.16
97 0.21
98 0.23
99 0.25
100 0.3
101 0.36
102 0.4
103 0.45
104 0.49
105 0.52
106 0.55
107 0.59
108 0.62
109 0.66
110 0.67
111 0.7
112 0.75
113 0.73
114 0.73
115 0.77
116 0.77
117 0.75
118 0.7
119 0.64
120 0.63
121 0.56
122 0.52
123 0.41
124 0.34
125 0.26
126 0.24
127 0.2
128 0.12
129 0.12
130 0.11
131 0.11
132 0.08
133 0.08
134 0.1
135 0.1
136 0.13
137 0.14
138 0.17
139 0.17
140 0.16
141 0.15
142 0.13
143 0.13
144 0.1
145 0.09
146 0.06
147 0.07
148 0.07
149 0.1
150 0.12
151 0.11
152 0.11
153 0.13
154 0.13
155 0.15
156 0.16
157 0.13
158 0.14
159 0.17
160 0.18
161 0.16
162 0.16
163 0.15
164 0.19
165 0.2
166 0.22
167 0.21
168 0.2
169 0.21
170 0.22
171 0.22
172 0.22
173 0.24
174 0.2
175 0.2
176 0.24
177 0.28
178 0.32
179 0.33
180 0.32
181 0.32
182 0.33
183 0.33
184 0.29
185 0.24
186 0.19
187 0.17
188 0.14
189 0.08
190 0.07
191 0.05
192 0.04
193 0.05
194 0.05
195 0.06
196 0.06
197 0.07
198 0.08
199 0.1
200 0.11
201 0.11
202 0.12
203 0.13
204 0.18
205 0.18
206 0.19
207 0.17
208 0.18
209 0.18
210 0.17
211 0.15
212 0.1
213 0.09
214 0.12
215 0.14
216 0.15
217 0.15
218 0.15
219 0.15
220 0.15
221 0.15
222 0.11
223 0.15
224 0.15
225 0.15
226 0.14
227 0.14
228 0.15
229 0.16
230 0.15
231 0.1
232 0.08
233 0.08
234 0.11
235 0.11
236 0.12
237 0.1
238 0.1
239 0.1
240 0.1
241 0.09
242 0.07
243 0.06
244 0.08
245 0.1
246 0.11
247 0.1
248 0.12
249 0.12
250 0.15
251 0.2
252 0.2
253 0.21
254 0.22
255 0.28
256 0.31
257 0.36
258 0.4
259 0.45
260 0.54
261 0.59
262 0.65
263 0.62
264 0.59
265 0.61
266 0.57
267 0.5
268 0.41
269 0.35
270 0.25
271 0.23
272 0.22
273 0.14
274 0.1
275 0.06
276 0.05
277 0.03
278 0.03
279 0.03
280 0.03
281 0.03
282 0.05
283 0.11
284 0.11
285 0.12
286 0.13
287 0.14
288 0.17
289 0.18
290 0.18
291 0.14
292 0.14
293 0.14
294 0.15
295 0.15
296 0.12
297 0.12
298 0.1
299 0.09
300 0.09
301 0.08
302 0.07
303 0.06
304 0.06
305 0.06
306 0.06
307 0.07
308 0.08
309 0.08
310 0.08
311 0.09
312 0.11
313 0.12
314 0.14
315 0.15
316 0.14
317 0.14
318 0.15
319 0.19
320 0.18
321 0.17
322 0.16
323 0.15
324 0.17
325 0.19
326 0.2
327 0.25
328 0.31
329 0.4
330 0.49
331 0.57
332 0.57
333 0.63
334 0.67
335 0.66
336 0.64
337 0.59
338 0.6
339 0.55
340 0.63
341 0.6
342 0.57
343 0.52
344 0.51
345 0.5
346 0.42
347 0.43
348 0.33
349 0.31
350 0.3
351 0.25
352 0.22
353 0.21
354 0.19
355 0.19
356 0.25
357 0.25
358 0.31
359 0.37
360 0.45
361 0.54
362 0.64
363 0.7
364 0.75
365 0.83
366 0.88
367 0.93
368 0.95
369 0.95
370 0.95
371 0.95
372 0.95
373 0.95
374 0.94
375 0.94
376 0.94
377 0.95
378 0.94
379 0.93
380 0.92