FuNGI

A0A3D8S024

Protein Details

Accession

A0A3D8S024

Localization Confidence

High

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
11-44	TATPPPPRLRHFSNPRTTKKRKRASSHTPSPSSS	Hydrophilic
97-124	FPHRPIPPENRVPPRRKRSRSVLEKTDE	Basic
321-352	DPEYAARERRRMRRKLRRRDRRWDEKEMVRNR	Basic

NLS Segment(s)

Position	Sequence
25-33	PRTTKKRKR
107-116	RVPPRRKRSR
134-138	RKEKG
327-343	RERRRMRRKLRRRDRRW

Subcellular Location(s)

mito 13, nucl 10, cyto 2

Family & Domain DBs

InterPro	View protein in InterPro IPR007224 TIF_Rrn11
Gene Ontology	GO:0001164 F:RNA polymerase I core promoter sequence-specific DNA binding GO:0001181 F:RNA polymerase I general transcription initiation factor activity
Pfam	View protein in Pfam PF04090 RNA_pol_I_TF

Amino Acid Sequences

MPLFALPLPTTATPPPPRLRHFSNPRTTKKRKRASSHTPSPSSSDNDDKPTYDDHDHYALPAASTNPLSLTPAEVAQYKLAGLELDEPLPSTQIPDFPHRPIPPENRVPPRRKRSRSVLEKTDEAEIDVPAKERKEKGPKLRVHHLGVLTAVLHRCLSDGDIPRATRAWSLLLRAEVGGKGLDIRNTGYWGIGAELLIRSPDEVEVDEDRVDDQRNPGEDENSGQGLRRWGTASGLQKAKNYFERLILQYPYIRQFHKSFTALDLWPAMLGCEIYGIQYEYQEGMRKIAAKEHEDEDEDERRSSSDESDGVPNEEEMEGEDPEYAARERRRMRRKLRRRDRRWDEKEMVRNRALAASEEIVERMDDLMTKLPYSENHTLLRLKGMLGLYIGDLSVPTRPSSEEEDKSRGPANRGLLMNRKLHAYEKGREKQAEERARAKMLFEKIVREGGRAGIDLRDLSPERDEDEDEDEYGGGYDYDTVMNRDD

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.39
2	0.47
3	0.52
4	0.57
5	0.61
6	0.67
7	0.69
8	0.74
9	0.76
10	0.78
11	0.8
12	0.85
13	0.88
14	0.9
15	0.91
16	0.91
17	0.91
18	0.9
19	0.9
20	0.91
21	0.91
22	0.91
23	0.91
24	0.9
25	0.84
26	0.76
27	0.7
28	0.64
29	0.57
30	0.51
31	0.49
32	0.43
33	0.44
34	0.44
35	0.41
36	0.39
37	0.37
38	0.37
39	0.34
40	0.32
41	0.29
42	0.31
43	0.3
44	0.28
45	0.29
46	0.24
47	0.2
48	0.19
49	0.16
50	0.15
51	0.16
52	0.15
53	0.12
54	0.12
55	0.14
56	0.12
57	0.13
58	0.12
59	0.12
60	0.14
61	0.14
62	0.15
63	0.14
64	0.14
65	0.11
66	0.11
67	0.1
68	0.08
69	0.08
70	0.1
71	0.1
72	0.11
73	0.11
74	0.12
75	0.11
76	0.12
77	0.11
78	0.1
79	0.1
80	0.13
81	0.17
82	0.24
83	0.27
84	0.3
85	0.38
86	0.37
87	0.41
88	0.45
89	0.5
90	0.51
91	0.57
92	0.62
93	0.65
94	0.73
95	0.77
96	0.79
97	0.82
98	0.85
99	0.83
100	0.82
101	0.82
102	0.84
103	0.86
104	0.84
105	0.82
106	0.75
107	0.71
108	0.64
109	0.56
110	0.45
111	0.35
112	0.27
113	0.18
114	0.16
115	0.14
116	0.14
117	0.13
118	0.15
119	0.18
120	0.21
121	0.29
122	0.38
123	0.47
124	0.55
125	0.63
126	0.68
127	0.71
128	0.77
129	0.75
130	0.68
131	0.64
132	0.54
133	0.45
134	0.38
135	0.31
136	0.22
137	0.18
138	0.14
139	0.09
140	0.09
141	0.08
142	0.08
143	0.08
144	0.09
145	0.13
146	0.17
147	0.21
148	0.24
149	0.25
150	0.25
151	0.26
152	0.25
153	0.19
154	0.16
155	0.16
156	0.13
157	0.15
158	0.16
159	0.16
160	0.15
161	0.15
162	0.15
163	0.11
164	0.1
165	0.08
166	0.06
167	0.08
168	0.08
169	0.09
170	0.09
171	0.1
172	0.1
173	0.12
174	0.12
175	0.1
176	0.09
177	0.08
178	0.08
179	0.07
180	0.06
181	0.05
182	0.05
183	0.05
184	0.05
185	0.05
186	0.04
187	0.04
188	0.05
189	0.05
190	0.05
191	0.08
192	0.09
193	0.1
194	0.1
195	0.09
196	0.1
197	0.1
198	0.11
199	0.09
200	0.1
201	0.12
202	0.13
203	0.16
204	0.16
205	0.16
206	0.15
207	0.16
208	0.16
209	0.14
210	0.13
211	0.1
212	0.11
213	0.12
214	0.12
215	0.12
216	0.11
217	0.1
218	0.12
219	0.16
220	0.19
221	0.22
222	0.25
223	0.25
224	0.27
225	0.28
226	0.29
227	0.28
228	0.28
229	0.24
230	0.23
231	0.25
232	0.25
233	0.27
234	0.25
235	0.21
236	0.19
237	0.2
238	0.22
239	0.21
240	0.19
241	0.2
242	0.21
243	0.23
244	0.26
245	0.26
246	0.22
247	0.22
248	0.25
249	0.21
250	0.2
251	0.17
252	0.13
253	0.11
254	0.1
255	0.08
256	0.04
257	0.04
258	0.03
259	0.03
260	0.03
261	0.04
262	0.04
263	0.05
264	0.05
265	0.05
266	0.06
267	0.06
268	0.07
269	0.11
270	0.11
271	0.11
272	0.12
273	0.15
274	0.15
275	0.19
276	0.21
277	0.2
278	0.22
279	0.23
280	0.24
281	0.22
282	0.24
283	0.23
284	0.24
285	0.23
286	0.21
287	0.19
288	0.18
289	0.18
290	0.17
291	0.14
292	0.12
293	0.12
294	0.14
295	0.16
296	0.17
297	0.16
298	0.16
299	0.14
300	0.13
301	0.11
302	0.09
303	0.08
304	0.09
305	0.08
306	0.08
307	0.08
308	0.07
309	0.07
310	0.08
311	0.07
312	0.11
313	0.14
314	0.21
315	0.3
316	0.4
317	0.5
318	0.59
319	0.7
320	0.76
321	0.84
322	0.88
323	0.92
324	0.93
325	0.93
326	0.94
327	0.93
328	0.93
329	0.9
330	0.88
331	0.84
332	0.81
333	0.81
334	0.76
335	0.72
336	0.62
337	0.55
338	0.46
339	0.42
340	0.34
341	0.26
342	0.21
343	0.16
344	0.16
345	0.15
346	0.14
347	0.12
348	0.11
349	0.09
350	0.07
351	0.06
352	0.06
353	0.07
354	0.11
355	0.12
356	0.12
357	0.12
358	0.13
359	0.15
360	0.22
361	0.26
362	0.25
363	0.27
364	0.3
365	0.31
366	0.3
367	0.32
368	0.24
369	0.19
370	0.2
371	0.18
372	0.15
373	0.14
374	0.14
375	0.11
376	0.1
377	0.1
378	0.05
379	0.05
380	0.05
381	0.08
382	0.09
383	0.09
384	0.1
385	0.11
386	0.15
387	0.23
388	0.3
389	0.33
390	0.38
391	0.43
392	0.43
393	0.45
394	0.47
395	0.43
396	0.39
397	0.39
398	0.38
399	0.38
400	0.4
401	0.42
402	0.45
403	0.48
404	0.48
405	0.44
406	0.42
407	0.37
408	0.38
409	0.42
410	0.4
411	0.42
412	0.48
413	0.55
414	0.6
415	0.6
416	0.6
417	0.6
418	0.64
419	0.65
420	0.61
421	0.59
422	0.56
423	0.58
424	0.55
425	0.49
426	0.46
427	0.41
428	0.43
429	0.38
430	0.39
431	0.37
432	0.44
433	0.42
434	0.36
435	0.33
436	0.28
437	0.28
438	0.24
439	0.23
440	0.17
441	0.18
442	0.17
443	0.16
444	0.2
445	0.19
446	0.21
447	0.23
448	0.22
449	0.23
450	0.25
451	0.26
452	0.22
453	0.25
454	0.25
455	0.22
456	0.22
457	0.19
458	0.17
459	0.15
460	0.13
461	0.08
462	0.06
463	0.07
464	0.07
465	0.09
466	0.1

A0A3D8S024

3D AlphaFold-predicted Structure Viewer