Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3D8QD71

Protein Details
Accession A0A3D8QD71    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
15-42LLWKIPWRLSKFQKQRQRRRLRAVDTVVHydrophilic
76-105DKYTIFDRKEKKYRKGIHKLPKWTRLSQRLHydrophilic
NLS Segment(s)
PositionSequence
84-97KEKKYRKGIHKLPK
Subcellular Location(s) mito 22.5, cyto_mito 13.333, cyto 3, cyto_nucl 2.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFKPTNALSGGLLWKIPWRLSKFQKQRQRRRLRAVDTVVSVIDQALAKKGITTKAVERWKDEMPIEQEMLPKDKYTIFDRKEKKYRKGIHKLPKWTRLSQRLNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.13
4 0.16
5 0.17
6 0.19
7 0.23
8 0.28
9 0.36
10 0.44
11 0.55
12 0.62
13 0.69
14 0.77
15 0.81
16 0.86
17 0.89
18 0.92
19 0.9
20 0.9
21 0.89
22 0.85
23 0.82
24 0.76
25 0.67
26 0.57
27 0.48
28 0.37
29 0.28
30 0.22
31 0.13
32 0.09
33 0.07
34 0.06
35 0.06
36 0.07
37 0.06
38 0.07
39 0.09
40 0.1
41 0.11
42 0.12
43 0.14
44 0.22
45 0.28
46 0.28
47 0.3
48 0.31
49 0.31
50 0.32
51 0.3
52 0.27
53 0.24
54 0.25
55 0.23
56 0.21
57 0.22
58 0.2
59 0.23
60 0.19
61 0.16
62 0.15
63 0.16
64 0.18
65 0.21
66 0.3
67 0.3
68 0.39
69 0.46
70 0.54
71 0.63
72 0.69
73 0.71
74 0.73
75 0.79
76 0.81
77 0.85
78 0.85
79 0.86
80 0.86
81 0.89
82 0.88
83 0.88
84 0.83
85 0.8
86 0.8
87 0.8
88 0.8
89 0.77
90 0.79