Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8N8D9

Protein Details
Accession B8N8D9    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
55-74KGPRRRSTAHHRREVRCQAHBasic
NLS Segment(s)
PositionSequence
29-34RKKKEK
Subcellular Location(s) nucl 10, mito 8, cyto 8, cyto_mito 8
Family & Domain DBs
Amino Acid Sequences MQREWNPIMPIGPFDHRIRDLPCHGTSGRKKKEKKILLTCAAVGIIDQRLAHGLKGPRRRSTAHHRREVRCQAHCGYGGRKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.27
4 0.3
5 0.31
6 0.33
7 0.34
8 0.35
9 0.34
10 0.33
11 0.32
12 0.37
13 0.43
14 0.48
15 0.54
16 0.57
17 0.62
18 0.67
19 0.77
20 0.76
21 0.77
22 0.75
23 0.74
24 0.7
25 0.66
26 0.56
27 0.46
28 0.38
29 0.27
30 0.17
31 0.1
32 0.06
33 0.05
34 0.05
35 0.05
36 0.07
37 0.07
38 0.07
39 0.12
40 0.17
41 0.24
42 0.33
43 0.38
44 0.42
45 0.46
46 0.48
47 0.5
48 0.57
49 0.61
50 0.61
51 0.66
52 0.7
53 0.71
54 0.79
55 0.82
56 0.79
57 0.73
58 0.69
59 0.62
60 0.58
61 0.57
62 0.51