Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3D8S6N6

Protein Details
Accession A0A3D8S6N6    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
96-127GVASKIEKPSRQQRKQRKNRQKTLRGTAKVKGHydrophilic
NLS Segment(s)
PositionSequence
98-133ASKIEKPSRQQRKQRKNRQKTLRGTAKVKGAKKKKE
Subcellular Location(s) mito 17, cyto 7, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADQPVTLRTRKFIRNPLLGRKQMVVDILHPNRANISKDDLRVKLAEMYKASKEQINVFGLQTQFGGGKTTGFALVYDSPEALSKFEPHYRKVRVGVASKIEKPSRQQRKQRKNRQKTLRGTAKVKGAKKKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.64
3 0.69
4 0.74
5 0.77
6 0.72
7 0.66
8 0.59
9 0.51
10 0.42
11 0.38
12 0.29
13 0.22
14 0.29
15 0.28
16 0.32
17 0.3
18 0.29
19 0.3
20 0.32
21 0.31
22 0.23
23 0.29
24 0.27
25 0.31
26 0.36
27 0.33
28 0.32
29 0.3
30 0.29
31 0.27
32 0.25
33 0.24
34 0.21
35 0.23
36 0.22
37 0.24
38 0.24
39 0.2
40 0.19
41 0.19
42 0.21
43 0.2
44 0.19
45 0.17
46 0.19
47 0.17
48 0.16
49 0.13
50 0.09
51 0.08
52 0.07
53 0.09
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.07
62 0.08
63 0.09
64 0.09
65 0.08
66 0.08
67 0.1
68 0.1
69 0.09
70 0.08
71 0.09
72 0.13
73 0.19
74 0.22
75 0.24
76 0.32
77 0.35
78 0.38
79 0.4
80 0.42
81 0.42
82 0.43
83 0.44
84 0.43
85 0.44
86 0.43
87 0.47
88 0.44
89 0.4
90 0.43
91 0.5
92 0.54
93 0.59
94 0.67
95 0.72
96 0.8
97 0.89
98 0.93
99 0.94
100 0.94
101 0.95
102 0.95
103 0.94
104 0.92
105 0.92
106 0.91
107 0.88
108 0.81
109 0.75
110 0.74
111 0.72
112 0.69
113 0.69