Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8NP01

Protein Details
Accession B8NP01    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
115-140KSKVKEWDPSKKKKEQQKTPIRIVYSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 22, golg 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016191  Ribonuclease/ribotoxin  
Gene Ontology GO:0003723  F:RNA binding  
GO:0004540  F:RNA nuclease activity  
Amino Acid Sequences MQLTKAILALALVVSPILAAPTEVGEGSVNTNVEARAVDTVTCTPDQNQSGVKFEVDVKAAKALAQKIGWTTDSTKSDYPHPFGDKEKLWAHIPLEANKCNSKTRMLEYPVYWTKSKVKEWDPSKKKKEQQKTPIRIVYSNLNGALHYCGTMIHKTVAKDFGGSGDFKLCQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.03
5 0.03
6 0.03
7 0.04
8 0.05
9 0.06
10 0.06
11 0.06
12 0.07
13 0.07
14 0.09
15 0.11
16 0.1
17 0.1
18 0.11
19 0.1
20 0.1
21 0.1
22 0.09
23 0.08
24 0.08
25 0.08
26 0.09
27 0.1
28 0.13
29 0.13
30 0.13
31 0.13
32 0.18
33 0.19
34 0.19
35 0.23
36 0.21
37 0.24
38 0.24
39 0.23
40 0.18
41 0.18
42 0.18
43 0.16
44 0.15
45 0.12
46 0.12
47 0.12
48 0.13
49 0.15
50 0.14
51 0.15
52 0.14
53 0.14
54 0.14
55 0.15
56 0.14
57 0.13
58 0.14
59 0.17
60 0.19
61 0.22
62 0.22
63 0.22
64 0.28
65 0.29
66 0.29
67 0.27
68 0.27
69 0.26
70 0.26
71 0.3
72 0.23
73 0.26
74 0.25
75 0.23
76 0.22
77 0.22
78 0.2
79 0.21
80 0.22
81 0.23
82 0.26
83 0.25
84 0.27
85 0.28
86 0.29
87 0.27
88 0.27
89 0.26
90 0.24
91 0.26
92 0.31
93 0.32
94 0.33
95 0.31
96 0.38
97 0.38
98 0.39
99 0.36
100 0.31
101 0.34
102 0.37
103 0.4
104 0.39
105 0.4
106 0.46
107 0.53
108 0.62
109 0.64
110 0.69
111 0.73
112 0.76
113 0.78
114 0.79
115 0.82
116 0.82
117 0.84
118 0.84
119 0.85
120 0.84
121 0.82
122 0.74
123 0.65
124 0.57
125 0.53
126 0.46
127 0.4
128 0.32
129 0.26
130 0.23
131 0.23
132 0.22
133 0.15
134 0.11
135 0.09
136 0.09
137 0.12
138 0.14
139 0.15
140 0.17
141 0.2
142 0.21
143 0.25
144 0.28
145 0.25
146 0.24
147 0.23
148 0.22
149 0.21
150 0.2
151 0.18