Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3D8S1R0

Protein Details
Accession A0A3D8S1R0    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-43MHHSQKWKGKHRADVNVPKTRRTYCKGKDCRKHTQHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MHHSQKWKGKHRADVNVPKTRRTYCKGKDCRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTACKTKAQLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.82
3 0.82
4 0.75
5 0.7
6 0.66
7 0.62
8 0.59
9 0.54
10 0.56
11 0.56
12 0.66
13 0.72
14 0.78
15 0.81
16 0.81
17 0.86
18 0.85
19 0.86
20 0.86
21 0.86
22 0.83
23 0.84
24 0.86
25 0.78
26 0.77
27 0.71
28 0.65
29 0.57
30 0.52
31 0.41
32 0.33
33 0.31
34 0.31
35 0.3
36 0.26
37 0.32
38 0.35
39 0.39
40 0.44
41 0.48
42 0.45
43 0.51
44 0.58
45 0.56
46 0.57
47 0.56
48 0.55
49 0.54
50 0.57
51 0.48
52 0.43
53 0.4
54 0.33
55 0.36
56 0.38
57 0.37
58 0.32
59 0.39
60 0.43
61 0.52
62 0.6
63 0.63
64 0.63
65 0.66
66 0.73
67 0.73
68 0.72
69 0.69
70 0.64
71 0.61
72 0.59
73 0.54
74 0.49
75 0.47
76 0.41
77 0.35
78 0.32
79 0.32
80 0.35
81 0.41
82 0.43
83 0.47
84 0.57
85 0.63
86 0.68
87 0.66
88 0.6
89 0.56
90 0.51
91 0.5
92 0.5
93 0.5
94 0.52
95 0.54
96 0.52
97 0.49
98 0.49
99 0.42