Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3D8QDH8

Protein Details
Accession A0A3D8QDH8   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
14-60RGNGWKKVTRKVYAKERKKGTMTRYTDTRPKPQKNRERSKSPARREQHydrophilic
NLS Segment(s)
PositionSequence
17-68GWKKVTRKVYAKERKKGTMTRYTDTRPKPQKNRERSKSPARREQEPSRRSRS
Subcellular Location(s) nucl 10cyto 10cyto_nucl 10
Family & Domain DBs
Amino Acid Sequences MPGQHHGKIHEINRGNGWKKVTRKVYAKERKKGTMTRYTDTRPKPQKNRERSKSPARREQEPSRRSRSPIRTSAAIDNSAEEIIPLNVSEDPAVGDHWALLHLDTTNGDWYIYNAALGKDLGARYAATNVLQGILQYWDINVDPTREPIIIRFGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.51
3 0.47
4 0.49
5 0.47
6 0.5
7 0.57
8 0.58
9 0.57
10 0.63
11 0.68
12 0.74
13 0.77
14 0.81
15 0.8
16 0.79
17 0.78
18 0.76
19 0.74
20 0.71
21 0.7
22 0.66
23 0.61
24 0.6
25 0.58
26 0.6
27 0.58
28 0.61
29 0.61
30 0.65
31 0.71
32 0.76
33 0.81
34 0.83
35 0.89
36 0.87
37 0.85
38 0.83
39 0.84
40 0.83
41 0.81
42 0.79
43 0.72
44 0.71
45 0.7
46 0.73
47 0.72
48 0.7
49 0.68
50 0.66
51 0.65
52 0.61
53 0.62
54 0.61
55 0.58
56 0.57
57 0.53
58 0.48
59 0.48
60 0.49
61 0.41
62 0.33
63 0.26
64 0.2
65 0.17
66 0.14
67 0.11
68 0.07
69 0.05
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.05
76 0.05
77 0.04
78 0.05
79 0.05
80 0.06
81 0.05
82 0.04
83 0.04
84 0.04
85 0.05
86 0.04
87 0.04
88 0.05
89 0.05
90 0.05
91 0.06
92 0.07
93 0.08
94 0.08
95 0.08
96 0.07
97 0.08
98 0.1
99 0.09
100 0.09
101 0.09
102 0.09
103 0.09
104 0.09
105 0.09
106 0.09
107 0.09
108 0.09
109 0.09
110 0.09
111 0.09
112 0.11
113 0.11
114 0.09
115 0.1
116 0.1
117 0.1
118 0.09
119 0.08
120 0.08
121 0.09
122 0.09
123 0.08
124 0.08
125 0.09
126 0.09
127 0.12
128 0.13
129 0.14
130 0.15
131 0.17
132 0.2
133 0.19
134 0.19
135 0.19