Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8N7I9

Protein Details
Accession B8N7I9    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
223-249GPLWMLPKAERRKLRRKFRGTQGLCLDHydrophilic
NLS Segment(s)
PositionSequence
230-240KAERRKLRRKF
Subcellular Location(s) nucl 9.5, cyto_nucl 9.5, cyto 8.5, pero 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR022085  OpdG  
Pfam View protein in Pfam  
PF12311  DUF3632  
Amino Acid Sequences MDQVQLRIETPAPHDFEAPIQTIINAAIQSTNPSPAKDAALTLDAVYLDYITSPNKDPESVLTLFWELINSFASQIPYESPAQEKLVNIVQELADITSEQTILNQKLWRNLPYFSSEFPQTWEVVSPSADDKEKKRRFVNLQAYAARILGLGLSSVETYAIWALSDVAEGVMIPVRGSPDLVSADLKDVDQLPFKAAAAGVWILYAGHALHGRDEAIGGTQGGPLWMLPKAERRKLRRKFRGTQGLCLDRWLLWKQQFAAIRDCGSVDTETRRIAENVVETMDRVDGHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.29
4 0.29
5 0.27
6 0.22
7 0.18
8 0.17
9 0.16
10 0.16
11 0.15
12 0.11
13 0.09
14 0.09
15 0.09
16 0.13
17 0.14
18 0.21
19 0.2
20 0.21
21 0.23
22 0.24
23 0.27
24 0.23
25 0.23
26 0.18
27 0.18
28 0.18
29 0.15
30 0.14
31 0.11
32 0.11
33 0.1
34 0.07
35 0.06
36 0.06
37 0.07
38 0.07
39 0.1
40 0.12
41 0.15
42 0.16
43 0.17
44 0.17
45 0.19
46 0.24
47 0.22
48 0.2
49 0.19
50 0.18
51 0.18
52 0.17
53 0.15
54 0.09
55 0.09
56 0.09
57 0.08
58 0.08
59 0.1
60 0.11
61 0.1
62 0.11
63 0.11
64 0.13
65 0.14
66 0.13
67 0.14
68 0.15
69 0.17
70 0.18
71 0.17
72 0.17
73 0.19
74 0.19
75 0.17
76 0.16
77 0.13
78 0.12
79 0.12
80 0.1
81 0.06
82 0.05
83 0.06
84 0.05
85 0.05
86 0.05
87 0.06
88 0.1
89 0.11
90 0.14
91 0.17
92 0.18
93 0.24
94 0.27
95 0.29
96 0.27
97 0.27
98 0.26
99 0.28
100 0.28
101 0.23
102 0.23
103 0.21
104 0.2
105 0.21
106 0.2
107 0.15
108 0.14
109 0.14
110 0.12
111 0.11
112 0.11
113 0.09
114 0.09
115 0.1
116 0.12
117 0.13
118 0.17
119 0.28
120 0.32
121 0.37
122 0.38
123 0.44
124 0.48
125 0.57
126 0.62
127 0.58
128 0.57
129 0.53
130 0.51
131 0.44
132 0.38
133 0.27
134 0.17
135 0.1
136 0.05
137 0.04
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.03
145 0.03
146 0.04
147 0.03
148 0.03
149 0.03
150 0.03
151 0.03
152 0.03
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.04
159 0.04
160 0.04
161 0.04
162 0.05
163 0.06
164 0.06
165 0.06
166 0.07
167 0.08
168 0.09
169 0.09
170 0.09
171 0.1
172 0.1
173 0.1
174 0.09
175 0.09
176 0.1
177 0.12
178 0.12
179 0.12
180 0.12
181 0.12
182 0.12
183 0.1
184 0.09
185 0.08
186 0.08
187 0.06
188 0.06
189 0.06
190 0.05
191 0.05
192 0.05
193 0.04
194 0.05
195 0.07
196 0.07
197 0.08
198 0.09
199 0.09
200 0.08
201 0.09
202 0.07
203 0.07
204 0.07
205 0.07
206 0.06
207 0.07
208 0.07
209 0.06
210 0.06
211 0.05
212 0.06
213 0.07
214 0.08
215 0.1
216 0.19
217 0.28
218 0.36
219 0.45
220 0.53
221 0.62
222 0.72
223 0.81
224 0.83
225 0.85
226 0.86
227 0.88
228 0.9
229 0.82
230 0.81
231 0.79
232 0.74
233 0.64
234 0.56
235 0.47
236 0.36
237 0.38
238 0.32
239 0.3
240 0.28
241 0.32
242 0.32
243 0.37
244 0.42
245 0.4
246 0.43
247 0.38
248 0.36
249 0.32
250 0.31
251 0.26
252 0.22
253 0.21
254 0.18
255 0.21
256 0.22
257 0.23
258 0.24
259 0.26
260 0.24
261 0.24
262 0.25
263 0.23
264 0.21
265 0.22
266 0.21
267 0.19
268 0.19
269 0.19