Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3D8S818

Protein Details
Accession A0A3D8S818    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
144-165IKPEMEKKEKEQRRKRWEQVVEBasic
NLS Segment(s)
PositionSequence
150-159KKEKEQRRKR
Subcellular Location(s) nucl 17, mito_nucl 12.166, cyto_nucl 11.666, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003034  SAP_dom  
IPR036361  SAP_dom_sf  
IPR024974  Sde2_N  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0007049  P:cell cycle  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF02037  SAP  
PF13019  Sde2_N_Ubi  
PROSITE View protein in PROSITE  
PS50800  SAP  
Amino Acid Sequences MASQTVNVLLTSFPGLDLPSTLSLPLPATTTISELQERLQDRLPAHSNRLILTTISNKQLPTSSSSPISDLLSGPQDGFLSLRLSVPLCGGKGGFGSQLRAAGGRMSSKRKKNQGDENASSRNLDGRRLRTVNEAKALAEYLAIKPEMEKKEKEQRRKRWEQVVELAEKREEEIRSGSKGKVDGKWVEDKEEAGERTREAVLAAMKSGNYKDNLLGISPESASGSGNSESEDEEMGGMDSKGTTPPSETEVPKSKSKSISFFGFDEDDEFMSSDADEEEEEEEEESEGEEDEENDAKPVNDVEMVEDAPAQAIPTVEEMIPAEPTILTEPTTASEPEPALEPESVAEPEPSAVEPVPQVQPKKVSQDYAKLKVPELKKLLQQRSLTVSGLKADLVARLQESDNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.09
4 0.1
5 0.12
6 0.13
7 0.13
8 0.13
9 0.13
10 0.14
11 0.15
12 0.14
13 0.13
14 0.12
15 0.13
16 0.14
17 0.17
18 0.17
19 0.19
20 0.2
21 0.18
22 0.19
23 0.24
24 0.25
25 0.25
26 0.28
27 0.29
28 0.28
29 0.36
30 0.41
31 0.39
32 0.43
33 0.44
34 0.41
35 0.37
36 0.39
37 0.32
38 0.25
39 0.25
40 0.26
41 0.26
42 0.29
43 0.3
44 0.28
45 0.28
46 0.31
47 0.28
48 0.29
49 0.28
50 0.27
51 0.28
52 0.29
53 0.29
54 0.27
55 0.27
56 0.21
57 0.18
58 0.17
59 0.16
60 0.16
61 0.14
62 0.14
63 0.12
64 0.11
65 0.11
66 0.1
67 0.09
68 0.09
69 0.1
70 0.1
71 0.11
72 0.11
73 0.13
74 0.13
75 0.12
76 0.12
77 0.12
78 0.11
79 0.11
80 0.12
81 0.13
82 0.12
83 0.14
84 0.14
85 0.15
86 0.15
87 0.15
88 0.14
89 0.12
90 0.13
91 0.17
92 0.21
93 0.29
94 0.37
95 0.46
96 0.54
97 0.62
98 0.7
99 0.72
100 0.78
101 0.79
102 0.8
103 0.76
104 0.74
105 0.68
106 0.6
107 0.52
108 0.41
109 0.36
110 0.27
111 0.29
112 0.29
113 0.29
114 0.36
115 0.37
116 0.38
117 0.42
118 0.47
119 0.44
120 0.42
121 0.39
122 0.31
123 0.31
124 0.3
125 0.2
126 0.15
127 0.12
128 0.08
129 0.1
130 0.09
131 0.09
132 0.1
133 0.17
134 0.22
135 0.25
136 0.26
137 0.31
138 0.41
139 0.49
140 0.59
141 0.62
142 0.67
143 0.74
144 0.82
145 0.83
146 0.82
147 0.8
148 0.74
149 0.71
150 0.65
151 0.59
152 0.51
153 0.44
154 0.35
155 0.29
156 0.25
157 0.21
158 0.16
159 0.13
160 0.15
161 0.16
162 0.2
163 0.22
164 0.22
165 0.2
166 0.23
167 0.24
168 0.23
169 0.26
170 0.24
171 0.25
172 0.32
173 0.31
174 0.3
175 0.28
176 0.25
177 0.22
178 0.24
179 0.21
180 0.15
181 0.16
182 0.13
183 0.14
184 0.14
185 0.13
186 0.09
187 0.1
188 0.09
189 0.09
190 0.09
191 0.07
192 0.07
193 0.08
194 0.09
195 0.09
196 0.09
197 0.1
198 0.1
199 0.11
200 0.11
201 0.1
202 0.1
203 0.09
204 0.09
205 0.08
206 0.07
207 0.06
208 0.06
209 0.06
210 0.06
211 0.08
212 0.07
213 0.07
214 0.08
215 0.08
216 0.08
217 0.09
218 0.08
219 0.06
220 0.06
221 0.06
222 0.05
223 0.05
224 0.05
225 0.04
226 0.04
227 0.04
228 0.06
229 0.06
230 0.06
231 0.07
232 0.08
233 0.13
234 0.18
235 0.18
236 0.23
237 0.32
238 0.35
239 0.39
240 0.41
241 0.41
242 0.44
243 0.45
244 0.44
245 0.39
246 0.4
247 0.38
248 0.35
249 0.33
250 0.27
251 0.24
252 0.2
253 0.17
254 0.13
255 0.11
256 0.11
257 0.08
258 0.07
259 0.07
260 0.06
261 0.05
262 0.05
263 0.04
264 0.05
265 0.06
266 0.06
267 0.06
268 0.06
269 0.07
270 0.06
271 0.07
272 0.06
273 0.05
274 0.05
275 0.05
276 0.05
277 0.05
278 0.07
279 0.08
280 0.08
281 0.08
282 0.09
283 0.08
284 0.09
285 0.09
286 0.08
287 0.08
288 0.08
289 0.1
290 0.11
291 0.11
292 0.11
293 0.1
294 0.09
295 0.08
296 0.08
297 0.06
298 0.05
299 0.05
300 0.05
301 0.07
302 0.08
303 0.08
304 0.09
305 0.09
306 0.09
307 0.1
308 0.09
309 0.08
310 0.07
311 0.08
312 0.09
313 0.09
314 0.09
315 0.09
316 0.1
317 0.11
318 0.13
319 0.13
320 0.12
321 0.14
322 0.14
323 0.14
324 0.16
325 0.15
326 0.15
327 0.15
328 0.14
329 0.12
330 0.14
331 0.14
332 0.13
333 0.12
334 0.1
335 0.1
336 0.11
337 0.11
338 0.11
339 0.1
340 0.1
341 0.11
342 0.15
343 0.2
344 0.25
345 0.27
346 0.29
347 0.36
348 0.38
349 0.46
350 0.46
351 0.47
352 0.47
353 0.55
354 0.6
355 0.6
356 0.63
357 0.56
358 0.56
359 0.56
360 0.54
361 0.53
362 0.51
363 0.49
364 0.5
365 0.58
366 0.63
367 0.63
368 0.62
369 0.57
370 0.58
371 0.56
372 0.5
373 0.42
374 0.35
375 0.3
376 0.28
377 0.23
378 0.17
379 0.15
380 0.16
381 0.16
382 0.16
383 0.15
384 0.16