Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3F3QE31

Protein Details
Accession A0A3F3QE31    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
89-110IWGLPMAWSRKRKRKKETKEKSBasic
NLS Segment(s)
PositionSequence
97-110SRKRKRKKETKEKS
Subcellular Location(s) plas 14, E.R. 6, extr 3, golg 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MWSVHNPSNADWRTSSVLLFLNIFFFFSNFCFCFFLSIPFSFPQLAYPDSLLPIGRNPDPGNELTRGASMEWGRCLNTPDVSKTVERGIWGLPMAWSRKRKRKKETKEKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.21
4 0.21
5 0.19
6 0.19
7 0.16
8 0.13
9 0.12
10 0.13
11 0.1
12 0.09
13 0.09
14 0.09
15 0.13
16 0.11
17 0.13
18 0.14
19 0.14
20 0.17
21 0.17
22 0.2
23 0.19
24 0.19
25 0.2
26 0.19
27 0.2
28 0.17
29 0.16
30 0.14
31 0.13
32 0.13
33 0.11
34 0.12
35 0.11
36 0.11
37 0.11
38 0.09
39 0.07
40 0.08
41 0.1
42 0.09
43 0.11
44 0.11
45 0.12
46 0.14
47 0.15
48 0.16
49 0.15
50 0.15
51 0.14
52 0.14
53 0.13
54 0.11
55 0.13
56 0.12
57 0.12
58 0.13
59 0.13
60 0.14
61 0.14
62 0.17
63 0.16
64 0.19
65 0.2
66 0.21
67 0.22
68 0.24
69 0.24
70 0.23
71 0.24
72 0.2
73 0.19
74 0.17
75 0.16
76 0.15
77 0.14
78 0.13
79 0.12
80 0.16
81 0.2
82 0.26
83 0.35
84 0.43
85 0.54
86 0.64
87 0.72
88 0.79
89 0.86
90 0.9