Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3F3QD86

Protein Details
Accession A0A3F3QD86   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-40QKSPKTPVSPKRMMRQKRDRRKRSLLRKAYEYSHydrophilic
NLS Segment(s)
PositionSequence
14-34PVSPKRMMRQKRDRRKRSLLR
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MPEEPNEQKSPKTPVSPKRMMRQKRDRRKRSLLRKAYEYSKLCDADICLGIRIRESGEVTTFLSDYTGFWSGFSSQLETYYPRPIRKTDKDFDSDPTDEDKSTTAETVGAAGTTGDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.64
3 0.71
4 0.72
5 0.75
6 0.79
7 0.79
8 0.81
9 0.82
10 0.84
11 0.86
12 0.91
13 0.9
14 0.89
15 0.92
16 0.91
17 0.91
18 0.91
19 0.89
20 0.84
21 0.81
22 0.76
23 0.7
24 0.68
25 0.59
26 0.51
27 0.46
28 0.41
29 0.35
30 0.31
31 0.26
32 0.2
33 0.19
34 0.16
35 0.12
36 0.12
37 0.11
38 0.11
39 0.11
40 0.09
41 0.08
42 0.09
43 0.08
44 0.08
45 0.09
46 0.09
47 0.09
48 0.09
49 0.07
50 0.07
51 0.06
52 0.05
53 0.07
54 0.09
55 0.08
56 0.09
57 0.1
58 0.1
59 0.12
60 0.12
61 0.11
62 0.1
63 0.11
64 0.12
65 0.14
66 0.15
67 0.22
68 0.26
69 0.27
70 0.3
71 0.35
72 0.43
73 0.5
74 0.56
75 0.55
76 0.57
77 0.58
78 0.57
79 0.57
80 0.54
81 0.45
82 0.38
83 0.36
84 0.31
85 0.26
86 0.25
87 0.22
88 0.17
89 0.18
90 0.17
91 0.12
92 0.11
93 0.11
94 0.12
95 0.1
96 0.08
97 0.07