Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3F3PHY8

Protein Details
Accession A0A3F3PHY8    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
23-46NEAGHKRGKRKGKDRNKGAKARNGBasic
NLS Segment(s)
PositionSequence
24-45EAGHKRGKRKGKDRNKGAKARN
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences CLIAVNGRPSGELDDLQTRGRANEAGHKRGKRKGKDRNKGAKARNGEDMVKRWREMESMVKDHRVDTVKYLRYRLC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.22
4 0.22
5 0.19
6 0.17
7 0.18
8 0.16
9 0.13
10 0.21
11 0.27
12 0.32
13 0.39
14 0.44
15 0.47
16 0.53
17 0.61
18 0.6
19 0.64
20 0.68
21 0.73
22 0.78
23 0.84
24 0.87
25 0.87
26 0.86
27 0.8
28 0.76
29 0.7
30 0.62
31 0.57
32 0.49
33 0.43
34 0.38
35 0.39
36 0.39
37 0.36
38 0.34
39 0.29
40 0.28
41 0.26
42 0.26
43 0.29
44 0.29
45 0.34
46 0.36
47 0.39
48 0.39
49 0.38
50 0.41
51 0.36
52 0.3
53 0.3
54 0.37
55 0.41
56 0.44