Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3F3PLU0

Protein Details
Accession A0A3F3PLU0    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
290-320AAASTPNHPSKNRRRRRPRYREVDSYRPGHKBasic
NLS Segment(s)
PositionSequence
299-310SKNRRRRRPRYR
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 6
Family & Domain DBs
Amino Acid Sequences MASRDGHMSEPFQRKVDELVRKYDCIIEPNAVLHAILQDPESLNSLVNAIQRQASLVRHRSQNPEDGEITVFDNALMILSGNGHDTQDIGALELYLAEYLGICTFSPIPHAKQGLHEYDMLQNTVTGGDLCPSTFHLAFLLWTILTSFAESVSNSTNDRTTAAEQQPHSSPEQAVNTHVQAHEHPRRQQHILPPRPPPTLEEIRRREQVERLLRIYEKAKAEYNKKNPEEIDVGLARYFRDTAETTLDFLRVNDMSDHPLIPDIEFSFERAKCKAAQLAGRGRHFDQPQAAASTPNHPSKNRRRRRPRYREVDSYRPGHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.46
4 0.47
5 0.42
6 0.48
7 0.5
8 0.5
9 0.5
10 0.5
11 0.42
12 0.36
13 0.35
14 0.29
15 0.26
16 0.25
17 0.25
18 0.19
19 0.17
20 0.13
21 0.12
22 0.1
23 0.09
24 0.09
25 0.1
26 0.11
27 0.12
28 0.14
29 0.13
30 0.12
31 0.12
32 0.12
33 0.13
34 0.15
35 0.15
36 0.13
37 0.14
38 0.14
39 0.15
40 0.17
41 0.2
42 0.26
43 0.32
44 0.36
45 0.42
46 0.46
47 0.53
48 0.53
49 0.56
50 0.51
51 0.49
52 0.44
53 0.39
54 0.35
55 0.28
56 0.25
57 0.18
58 0.14
59 0.09
60 0.08
61 0.07
62 0.06
63 0.05
64 0.04
65 0.03
66 0.04
67 0.04
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.08
75 0.08
76 0.07
77 0.07
78 0.07
79 0.07
80 0.06
81 0.06
82 0.04
83 0.04
84 0.03
85 0.03
86 0.03
87 0.04
88 0.04
89 0.04
90 0.05
91 0.06
92 0.06
93 0.11
94 0.13
95 0.15
96 0.2
97 0.22
98 0.21
99 0.25
100 0.3
101 0.28
102 0.27
103 0.26
104 0.22
105 0.25
106 0.25
107 0.2
108 0.16
109 0.13
110 0.11
111 0.1
112 0.09
113 0.05
114 0.04
115 0.05
116 0.05
117 0.05
118 0.05
119 0.06
120 0.09
121 0.09
122 0.09
123 0.09
124 0.09
125 0.09
126 0.09
127 0.08
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.04
135 0.04
136 0.05
137 0.05
138 0.06
139 0.07
140 0.08
141 0.09
142 0.09
143 0.09
144 0.09
145 0.1
146 0.11
147 0.11
148 0.17
149 0.19
150 0.22
151 0.22
152 0.25
153 0.25
154 0.25
155 0.24
156 0.18
157 0.16
158 0.16
159 0.18
160 0.16
161 0.16
162 0.16
163 0.16
164 0.16
165 0.16
166 0.13
167 0.13
168 0.21
169 0.27
170 0.31
171 0.35
172 0.38
173 0.42
174 0.45
175 0.48
176 0.49
177 0.51
178 0.55
179 0.56
180 0.58
181 0.58
182 0.56
183 0.53
184 0.45
185 0.42
186 0.43
187 0.44
188 0.47
189 0.48
190 0.52
191 0.56
192 0.55
193 0.5
194 0.45
195 0.47
196 0.46
197 0.44
198 0.41
199 0.39
200 0.38
201 0.38
202 0.36
203 0.33
204 0.27
205 0.25
206 0.29
207 0.32
208 0.4
209 0.47
210 0.54
211 0.59
212 0.58
213 0.59
214 0.54
215 0.52
216 0.47
217 0.38
218 0.33
219 0.24
220 0.23
221 0.2
222 0.2
223 0.16
224 0.14
225 0.13
226 0.08
227 0.11
228 0.12
229 0.13
230 0.19
231 0.19
232 0.2
233 0.2
234 0.21
235 0.17
236 0.16
237 0.18
238 0.12
239 0.13
240 0.13
241 0.14
242 0.17
243 0.18
244 0.18
245 0.14
246 0.17
247 0.16
248 0.14
249 0.15
250 0.12
251 0.15
252 0.15
253 0.17
254 0.21
255 0.23
256 0.26
257 0.24
258 0.26
259 0.25
260 0.29
261 0.31
262 0.3
263 0.34
264 0.39
265 0.47
266 0.52
267 0.53
268 0.53
269 0.5
270 0.53
271 0.49
272 0.45
273 0.41
274 0.37
275 0.36
276 0.37
277 0.35
278 0.31
279 0.31
280 0.32
281 0.34
282 0.38
283 0.4
284 0.4
285 0.51
286 0.58
287 0.68
288 0.73
289 0.78
290 0.82
291 0.88
292 0.95
293 0.96
294 0.96
295 0.95
296 0.94
297 0.94
298 0.91
299 0.9
300 0.86