Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3F3PVF5

Protein Details
Accession A0A3F3PVF5    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-42MPPQFGNSTSWRKKRQTRGSLVDIKRKAKADRERFRRGKRGVHydrophilic
NLS Segment(s)
PositionSequence
12-42RKKRQTRGSLVDIKRKAKADRERFRRGKRGV
Subcellular Location(s) nucl 11.5, mito_nucl 10.833, cyto_nucl 10.166, mito 8, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MPPQFGNSTSWRKKRQTRGSLVDIKRKAKADRERFRRGKRGVYKRLNDLYLDGLDTGREVRIYTLFMRKPKGCRGTIQYSTYNSHPHEKWVPSAEKVVSPMLLFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.84
3 0.84
4 0.84
5 0.83
6 0.83
7 0.84
8 0.8
9 0.78
10 0.73
11 0.66
12 0.61
13 0.58
14 0.52
15 0.52
16 0.57
17 0.58
18 0.62
19 0.68
20 0.74
21 0.79
22 0.82
23 0.82
24 0.76
25 0.75
26 0.75
27 0.77
28 0.76
29 0.77
30 0.73
31 0.7
32 0.7
33 0.61
34 0.5
35 0.41
36 0.32
37 0.23
38 0.19
39 0.12
40 0.08
41 0.07
42 0.07
43 0.06
44 0.04
45 0.04
46 0.04
47 0.05
48 0.06
49 0.08
50 0.1
51 0.17
52 0.2
53 0.23
54 0.29
55 0.32
56 0.36
57 0.44
58 0.48
59 0.43
60 0.45
61 0.5
62 0.53
63 0.55
64 0.55
65 0.5
66 0.46
67 0.47
68 0.44
69 0.42
70 0.36
71 0.37
72 0.33
73 0.36
74 0.39
75 0.38
76 0.41
77 0.44
78 0.45
79 0.4
80 0.45
81 0.4
82 0.35
83 0.35
84 0.32
85 0.25