Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3F3QDT7

Protein Details
Accession A0A3F3QDT7    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
15-40GEEQQCQKNKKMKKITPKNHPNSQNIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MQSHPNGSYEIVVWGEEQQCQKNKKMKKITPKNHPNSQNIGRVPMYGIVKGIAFFYPFLSLSHLSLPENRETVLGREKVEIKKIHRKQYEKTINIRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.16
4 0.19
5 0.23
6 0.3
7 0.33
8 0.4
9 0.45
10 0.51
11 0.58
12 0.66
13 0.68
14 0.72
15 0.8
16 0.82
17 0.85
18 0.88
19 0.86
20 0.84
21 0.83
22 0.76
23 0.72
24 0.68
25 0.64
26 0.53
27 0.49
28 0.4
29 0.33
30 0.29
31 0.25
32 0.2
33 0.13
34 0.13
35 0.1
36 0.09
37 0.09
38 0.09
39 0.06
40 0.05
41 0.06
42 0.06
43 0.07
44 0.07
45 0.08
46 0.1
47 0.11
48 0.11
49 0.13
50 0.13
51 0.13
52 0.15
53 0.18
54 0.17
55 0.17
56 0.16
57 0.16
58 0.16
59 0.19
60 0.23
61 0.23
62 0.22
63 0.25
64 0.3
65 0.33
66 0.39
67 0.41
68 0.42
69 0.51
70 0.58
71 0.65
72 0.68
73 0.71
74 0.71
75 0.76
76 0.8
77 0.75