Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3F3PH27

Protein Details
Accession A0A3F3PH27    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
9-35AHPGYWYSPSNKKKRSRTTRARSQGLAHydrophilic
NLS Segment(s)
PositionSequence
21-23KKR
Subcellular Location(s) nucl 16, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MEKRNHTRAHPGYWYSPSNKKKRSRTTRARSQGLAVLSMPSSTPGQSSQSNAWSTSLDSDRTSEHSTGSSHAEEGTFTKRNVLHSNGCSPLQSAASVWWQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.49
3 0.54
4 0.56
5 0.59
6 0.64
7 0.69
8 0.74
9 0.8
10 0.85
11 0.87
12 0.89
13 0.89
14 0.91
15 0.9
16 0.85
17 0.74
18 0.66
19 0.58
20 0.48
21 0.38
22 0.27
23 0.19
24 0.14
25 0.13
26 0.1
27 0.08
28 0.08
29 0.07
30 0.07
31 0.08
32 0.11
33 0.11
34 0.14
35 0.14
36 0.17
37 0.18
38 0.17
39 0.17
40 0.14
41 0.14
42 0.15
43 0.15
44 0.12
45 0.12
46 0.12
47 0.13
48 0.16
49 0.19
50 0.16
51 0.15
52 0.15
53 0.16
54 0.17
55 0.19
56 0.15
57 0.13
58 0.13
59 0.12
60 0.11
61 0.13
62 0.17
63 0.17
64 0.16
65 0.21
66 0.23
67 0.27
68 0.32
69 0.35
70 0.37
71 0.38
72 0.43
73 0.42
74 0.41
75 0.37
76 0.33
77 0.3
78 0.24
79 0.2
80 0.15