Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3F3PS04

Protein Details
Accession A0A3F3PS04   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
38-66QPETSRSYRNIPRPRKKRKHMGTCRPWLIHydrophilic
NLS Segment(s)
PositionSequence
49-56PRPRKKRK
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 4, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MLQELLSSRSSHSTTSRASWRLLDTAGNTHCGCWSLNQPETSRSYRNIPRPRKKRKHMGTCRPWLILPAVVLQAPFFLRGCIKRYSGPVSVWRGSHHILRIRKDERKFEPSTVAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.32
3 0.38
4 0.36
5 0.36
6 0.36
7 0.35
8 0.33
9 0.3
10 0.26
11 0.21
12 0.24
13 0.24
14 0.25
15 0.22
16 0.2
17 0.2
18 0.19
19 0.17
20 0.13
21 0.19
22 0.21
23 0.25
24 0.27
25 0.28
26 0.3
27 0.35
28 0.36
29 0.32
30 0.29
31 0.32
32 0.36
33 0.45
34 0.52
35 0.58
36 0.65
37 0.73
38 0.82
39 0.86
40 0.88
41 0.88
42 0.89
43 0.89
44 0.89
45 0.9
46 0.87
47 0.85
48 0.79
49 0.69
50 0.58
51 0.48
52 0.38
53 0.29
54 0.2
55 0.13
56 0.11
57 0.1
58 0.1
59 0.08
60 0.08
61 0.07
62 0.08
63 0.06
64 0.07
65 0.1
66 0.12
67 0.16
68 0.19
69 0.21
70 0.22
71 0.27
72 0.32
73 0.32
74 0.32
75 0.36
76 0.39
77 0.4
78 0.38
79 0.35
80 0.34
81 0.33
82 0.34
83 0.34
84 0.35
85 0.39
86 0.44
87 0.51
88 0.56
89 0.62
90 0.65
91 0.68
92 0.68
93 0.7
94 0.68
95 0.62