Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3F3QJK3

Protein Details
Accession A0A3F3QJK3    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
40-71NGSRRGRETAKKRKGIKKKKGINPPDRNHRVIBasic
NLS Segment(s)
PositionSequence
37-63RKANGSRRGRETAKKRKGIKKKKGINP
Subcellular Location(s) mito 13.5, cyto_mito 8, nucl 7, plas 3, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MHPWIISLLIDLSAHSTSPPFSFFVLFYFMSLGFINRKANGSRRGRETAKKRKGIKKKKGINPPDRNHRVIDPMCIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.09
5 0.1
6 0.11
7 0.1
8 0.1
9 0.11
10 0.11
11 0.12
12 0.14
13 0.13
14 0.12
15 0.12
16 0.11
17 0.11
18 0.11
19 0.1
20 0.08
21 0.1
22 0.11
23 0.11
24 0.13
25 0.13
26 0.19
27 0.27
28 0.33
29 0.35
30 0.39
31 0.45
32 0.47
33 0.54
34 0.59
35 0.62
36 0.64
37 0.69
38 0.73
39 0.77
40 0.84
41 0.86
42 0.87
43 0.86
44 0.87
45 0.88
46 0.9
47 0.9
48 0.9
49 0.9
50 0.89
51 0.89
52 0.85
53 0.78
54 0.71
55 0.63
56 0.61
57 0.52