Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3F3PIC8

Protein Details
Accession A0A3F3PIC8    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
54-74CGIKWGNERRREIREKRRQGNBasic
NLS Segment(s)
PositionSequence
62-71RRREIREKRR
Subcellular Location(s) nucl 12, mito 11, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR044272  GATA18/19/20  
IPR000679  Znf_GATA  
IPR013088  Znf_NHR/GATA  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00320  GATA  
PROSITE View protein in PROSITE  
PS50114  GATA_ZN_FINGER_2  
Amino Acid Sequences MSITRVAKVETMAHNRRSSTQYALQGKQCERCRNQSTPLWRNGPRAARELCNACGIKWGNERRREIREKRRQGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.45
3 0.47
4 0.45
5 0.41
6 0.37
7 0.37
8 0.4
9 0.44
10 0.46
11 0.46
12 0.48
13 0.47
14 0.5
15 0.5
16 0.49
17 0.46
18 0.52
19 0.54
20 0.52
21 0.54
22 0.51
23 0.55
24 0.52
25 0.54
26 0.51
27 0.48
28 0.48
29 0.49
30 0.49
31 0.42
32 0.42
33 0.39
34 0.35
35 0.37
36 0.36
37 0.32
38 0.33
39 0.31
40 0.25
41 0.3
42 0.29
43 0.3
44 0.35
45 0.44
46 0.45
47 0.53
48 0.6
49 0.6
50 0.68
51 0.74
52 0.76
53 0.77
54 0.8