Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3F3PVE7

Protein Details
Accession A0A3F3PVE7   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MGKPRTLRHRRSDSAKSRRQQRYRRRTLLLLKHydrophilic
NLS Segment(s)
PositionSequence
7-24LRHRRSDSAKSRRQQRYR
Subcellular Location(s) mito_nucl 11.833, mito 11.5, nucl 11, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MGKPRTLRHRRSDSAKSRRQQRYRRRTLLLLKAFEFCKECEADVSLMIRSKHNGEIFYFNSDNSWTLSRETLAMHYPRPKQVTWQELAAHYSDPSDVGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.8
4 0.81
5 0.85
6 0.86
7 0.86
8 0.86
9 0.87
10 0.89
11 0.89
12 0.83
13 0.8
14 0.78
15 0.78
16 0.74
17 0.65
18 0.55
19 0.51
20 0.46
21 0.39
22 0.32
23 0.22
24 0.18
25 0.16
26 0.14
27 0.12
28 0.13
29 0.12
30 0.11
31 0.12
32 0.1
33 0.12
34 0.12
35 0.12
36 0.11
37 0.12
38 0.16
39 0.16
40 0.16
41 0.15
42 0.19
43 0.2
44 0.24
45 0.23
46 0.19
47 0.18
48 0.18
49 0.17
50 0.14
51 0.14
52 0.1
53 0.11
54 0.12
55 0.12
56 0.12
57 0.12
58 0.13
59 0.16
60 0.17
61 0.2
62 0.27
63 0.3
64 0.36
65 0.39
66 0.37
67 0.4
68 0.47
69 0.5
70 0.45
71 0.46
72 0.42
73 0.41
74 0.42
75 0.35
76 0.27
77 0.2
78 0.18
79 0.14