Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3F3Q6S2

Protein Details
Accession A0A3F3Q6S2    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-31RLVTDRRSKRFLPKKRLRKILRNNIDGIHydrophilic
NLS Segment(s)
PositionSequence
9-27RRSKRFLPKKRLRKILRNN
37-38RR
Subcellular Location(s) nucl 12.5, cyto_nucl 11.5, cyto 7.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR001951  Histone_H4  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Amino Acid Sequences MDPRLVTDRRSKRFLPKKRLRKILRNNIDGITRPSIRRLARRGGVIRISADVYPEVRKTVKNRLTEIIRQIILVMESSTTPGHERKLVRTQDVVFALNRMGHTLYGFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.76
3 0.76
4 0.81
5 0.85
6 0.92
7 0.89
8 0.9
9 0.9
10 0.9
11 0.89
12 0.82
13 0.74
14 0.65
15 0.59
16 0.5
17 0.43
18 0.36
19 0.29
20 0.26
21 0.26
22 0.3
23 0.31
24 0.37
25 0.37
26 0.39
27 0.4
28 0.45
29 0.45
30 0.43
31 0.41
32 0.35
33 0.31
34 0.24
35 0.22
36 0.16
37 0.14
38 0.11
39 0.09
40 0.1
41 0.1
42 0.1
43 0.1
44 0.13
45 0.16
46 0.26
47 0.31
48 0.33
49 0.36
50 0.39
51 0.43
52 0.44
53 0.45
54 0.38
55 0.32
56 0.28
57 0.26
58 0.21
59 0.16
60 0.13
61 0.09
62 0.05
63 0.05
64 0.07
65 0.07
66 0.07
67 0.09
68 0.11
69 0.13
70 0.18
71 0.21
72 0.26
73 0.35
74 0.39
75 0.4
76 0.43
77 0.42
78 0.43
79 0.43
80 0.38
81 0.29
82 0.26
83 0.24
84 0.21
85 0.2
86 0.15
87 0.14
88 0.13