Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7TTX0

Protein Details
Accession A7TTX0   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
157-183SNQLRLPKPLKKKEMGKKFGKPRSRGGBasic
NLS Segment(s)
PositionSequence
163-183PKPLKKKEMGKKFGKPRSRGG
Subcellular Location(s) nucl 12.5, cyto_nucl 9.5, cyto 5.5, cysk 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR035179  DUF5314  
KEGG vpo:Kpol_99p1  -  
Pfam View protein in Pfam  
PF17241  Retrotran_gag_4  
Amino Acid Sequences MSHPDQQSNNTHLFQSQEIGAVLVSNLRKQVMSPANATDLIPIELLGVQNYDMWYHYFMQVVGEASHIWSEYVETGDIQSVRIEYGLPDIQIKSMKIILDTNLVSLIKKNVSKDIEKKIRKLFLKTKRSGPTGMVLLEYLKKNYGRKGVSPPCLFFSNQLRLPKPLKKKEMGKKFGKPRSRGGIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.23
3 0.19
4 0.16
5 0.15
6 0.14
7 0.13
8 0.1
9 0.09
10 0.11
11 0.11
12 0.11
13 0.12
14 0.12
15 0.12
16 0.13
17 0.22
18 0.25
19 0.27
20 0.28
21 0.29
22 0.3
23 0.31
24 0.31
25 0.22
26 0.17
27 0.15
28 0.12
29 0.1
30 0.08
31 0.08
32 0.09
33 0.07
34 0.06
35 0.06
36 0.07
37 0.07
38 0.07
39 0.07
40 0.08
41 0.1
42 0.11
43 0.11
44 0.11
45 0.11
46 0.11
47 0.11
48 0.11
49 0.09
50 0.08
51 0.08
52 0.07
53 0.07
54 0.07
55 0.06
56 0.05
57 0.05
58 0.05
59 0.06
60 0.05
61 0.05
62 0.05
63 0.07
64 0.07
65 0.07
66 0.07
67 0.06
68 0.06
69 0.06
70 0.06
71 0.04
72 0.07
73 0.08
74 0.08
75 0.08
76 0.08
77 0.1
78 0.11
79 0.11
80 0.09
81 0.1
82 0.1
83 0.09
84 0.1
85 0.1
86 0.11
87 0.11
88 0.1
89 0.1
90 0.1
91 0.09
92 0.1
93 0.11
94 0.11
95 0.13
96 0.14
97 0.18
98 0.22
99 0.27
100 0.32
101 0.41
102 0.48
103 0.5
104 0.55
105 0.55
106 0.6
107 0.57
108 0.6
109 0.59
110 0.6
111 0.66
112 0.65
113 0.67
114 0.66
115 0.66
116 0.59
117 0.51
118 0.44
119 0.36
120 0.33
121 0.24
122 0.18
123 0.16
124 0.19
125 0.18
126 0.15
127 0.16
128 0.19
129 0.21
130 0.26
131 0.33
132 0.33
133 0.36
134 0.46
135 0.51
136 0.57
137 0.58
138 0.55
139 0.51
140 0.5
141 0.46
142 0.4
143 0.39
144 0.38
145 0.41
146 0.45
147 0.44
148 0.47
149 0.54
150 0.58
151 0.61
152 0.63
153 0.65
154 0.67
155 0.75
156 0.8
157 0.84
158 0.85
159 0.83
160 0.84
161 0.86
162 0.87
163 0.86
164 0.81
165 0.79