Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3F3PQP4

Protein Details
Accession A0A3F3PQP4    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
28-56TTNISRPPQHRPRKTQRLRLNKHIRKPEQHydrophilic
NLS Segment(s)
PositionSequence
37-53HRPRKTQRLRLNKHIRK
Subcellular Location(s) nucl 21, mito 5
Family & Domain DBs
Amino Acid Sequences MNPKIKNLIIKTQNELQLPPPQHQSSNTTNISRPPQHRPRKTQRLRLNKHIRKPEQDPRYRVPCPDTIDHVVREACV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.45
3 0.38
4 0.38
5 0.37
6 0.34
7 0.34
8 0.31
9 0.32
10 0.32
11 0.35
12 0.32
13 0.38
14 0.38
15 0.33
16 0.32
17 0.35
18 0.38
19 0.39
20 0.38
21 0.4
22 0.47
23 0.56
24 0.63
25 0.68
26 0.73
27 0.78
28 0.83
29 0.83
30 0.82
31 0.83
32 0.82
33 0.84
34 0.85
35 0.81
36 0.81
37 0.82
38 0.77
39 0.73
40 0.75
41 0.74
42 0.73
43 0.74
44 0.72
45 0.69
46 0.71
47 0.66
48 0.61
49 0.56
50 0.51
51 0.49
52 0.46
53 0.45
54 0.43
55 0.45
56 0.43
57 0.42