Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3F3PH51

Protein Details
Accession A0A3F3PH51   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-28APSQSRVKQEQLRKRRNNLLRRINDFWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito_nucl 12.333, cyto_nucl 10.333, mito 5.5
Family & Domain DBs
Amino Acid Sequences MAPSQSRVKQEQLRKRRNNLLRRINDFWRLYAIRSWAILEMPNRRIYTYQSHPHLPAPTAEELEDWPQPVTHRTPADYTTQPTTNVAIPHPPTFNILGRQYDGWDSVFTKCGVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.85
4 0.86
5 0.86
6 0.85
7 0.85
8 0.82
9 0.81
10 0.78
11 0.73
12 0.71
13 0.62
14 0.53
15 0.48
16 0.4
17 0.34
18 0.31
19 0.29
20 0.22
21 0.21
22 0.21
23 0.15
24 0.14
25 0.15
26 0.16
27 0.19
28 0.21
29 0.25
30 0.25
31 0.25
32 0.25
33 0.25
34 0.29
35 0.3
36 0.34
37 0.33
38 0.35
39 0.36
40 0.37
41 0.35
42 0.29
43 0.22
44 0.19
45 0.17
46 0.15
47 0.14
48 0.11
49 0.11
50 0.13
51 0.12
52 0.09
53 0.09
54 0.09
55 0.09
56 0.12
57 0.14
58 0.17
59 0.18
60 0.19
61 0.21
62 0.22
63 0.27
64 0.26
65 0.27
66 0.26
67 0.26
68 0.25
69 0.24
70 0.24
71 0.22
72 0.21
73 0.19
74 0.2
75 0.22
76 0.24
77 0.24
78 0.23
79 0.23
80 0.25
81 0.27
82 0.27
83 0.28
84 0.28
85 0.29
86 0.29
87 0.28
88 0.26
89 0.25
90 0.2
91 0.19
92 0.18
93 0.17
94 0.2