Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3F3PTS6

Protein Details
Accession A0A3F3PTS6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MCCPGGRLRYSRRRDCKNDSLISHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, golg 4, plas 2, extr 2, E.R. 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MCCPGGRLRYSRRRDCKNDSLISGTKLSGFSIALAIFLSFSASLISKIGVRSAFFALH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.83
3 0.82
4 0.8
5 0.74
6 0.65
7 0.61
8 0.53
9 0.47
10 0.39
11 0.29
12 0.21
13 0.18
14 0.16
15 0.1
16 0.09
17 0.07
18 0.07
19 0.06
20 0.05
21 0.05
22 0.05
23 0.04
24 0.04
25 0.05
26 0.04
27 0.04
28 0.05
29 0.05
30 0.06
31 0.06
32 0.07
33 0.08
34 0.09
35 0.12
36 0.13
37 0.13
38 0.16