Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3F3PI34

Protein Details
Accession A0A3F3PI34   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-35MAAKKRSIRRRRSSSKRSTYQRRNRRRNSLFLKAFHydrophilic
NLS Segment(s)
PositionSequence
4-27KKRSIRRRRSSSKRSTYQRRNRRR
Subcellular Location(s) nucl 19.5, mito_nucl 13.666, cyto_nucl 11.333, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MAAKKRSIRRRRSSSKRSTYQRRNRRRNSLFLKAFEYCNLCEADIALVIRLKHNGQVSKFNSNSQWHPSREELVGNLYDSLKDMSYPKPREITWGELAAQYEIGEAKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.93
3 0.92
4 0.91
5 0.91
6 0.92
7 0.91
8 0.92
9 0.92
10 0.92
11 0.92
12 0.93
13 0.88
14 0.87
15 0.84
16 0.84
17 0.78
18 0.69
19 0.64
20 0.55
21 0.49
22 0.41
23 0.36
24 0.25
25 0.21
26 0.19
27 0.14
28 0.12
29 0.12
30 0.1
31 0.08
32 0.08
33 0.06
34 0.07
35 0.07
36 0.08
37 0.09
38 0.09
39 0.11
40 0.14
41 0.17
42 0.17
43 0.26
44 0.28
45 0.34
46 0.35
47 0.33
48 0.34
49 0.34
50 0.35
51 0.33
52 0.37
53 0.31
54 0.34
55 0.34
56 0.33
57 0.31
58 0.29
59 0.22
60 0.19
61 0.18
62 0.15
63 0.14
64 0.12
65 0.11
66 0.11
67 0.11
68 0.08
69 0.09
70 0.11
71 0.17
72 0.27
73 0.31
74 0.33
75 0.36
76 0.36
77 0.42
78 0.44
79 0.44
80 0.38
81 0.38
82 0.35
83 0.33
84 0.34
85 0.27
86 0.23
87 0.16
88 0.13