Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3F3Q248

Protein Details
Accession A0A3F3Q248   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
63-85RSCMDAPKPKTQRRNPINYHLMRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 6.5, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MPPKGVSTRLNPVRLQSIPHLRVRRPNTNEPNTCVAVMSSMLSCWASQGYTHEGCAILEQQLRSCMDAPKPKTQRRNPINYHLMRMFPKVVGPKKKDGVLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.42
3 0.39
4 0.42
5 0.42
6 0.49
7 0.52
8 0.49
9 0.57
10 0.61
11 0.63
12 0.61
13 0.67
14 0.69
15 0.73
16 0.73
17 0.69
18 0.66
19 0.56
20 0.49
21 0.38
22 0.28
23 0.19
24 0.15
25 0.12
26 0.07
27 0.05
28 0.06
29 0.06
30 0.06
31 0.05
32 0.05
33 0.05
34 0.05
35 0.07
36 0.11
37 0.11
38 0.11
39 0.12
40 0.11
41 0.11
42 0.12
43 0.1
44 0.07
45 0.09
46 0.09
47 0.09
48 0.12
49 0.12
50 0.13
51 0.14
52 0.15
53 0.2
54 0.28
55 0.32
56 0.4
57 0.49
58 0.55
59 0.64
60 0.7
61 0.75
62 0.76
63 0.82
64 0.78
65 0.78
66 0.8
67 0.72
68 0.7
69 0.61
70 0.57
71 0.49
72 0.46
73 0.38
74 0.28
75 0.31
76 0.34
77 0.41
78 0.47
79 0.5
80 0.55
81 0.58