Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3F3PRI3

Protein Details
Accession A0A3F3PRI3    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-31AKTRQPIKARKSYKSTRTRNRDTSQKLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 9, cyto_nucl 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MRLPAKTRQPIKARKSYKSTRTRNRDTSQKLSHCIHYNRSRSEGAALRHLSHLCCLVAIDISFWSTWQKSVLTESLVNELKQGEGGVKGGESSGVST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.79
3 0.79
4 0.8
5 0.8
6 0.82
7 0.82
8 0.85
9 0.86
10 0.86
11 0.82
12 0.82
13 0.79
14 0.77
15 0.76
16 0.69
17 0.66
18 0.59
19 0.57
20 0.55
21 0.5
22 0.5
23 0.49
24 0.51
25 0.48
26 0.5
27 0.45
28 0.38
29 0.39
30 0.35
31 0.28
32 0.28
33 0.27
34 0.24
35 0.25
36 0.25
37 0.21
38 0.17
39 0.17
40 0.1
41 0.09
42 0.08
43 0.06
44 0.06
45 0.06
46 0.06
47 0.05
48 0.06
49 0.06
50 0.06
51 0.08
52 0.08
53 0.09
54 0.1
55 0.1
56 0.1
57 0.14
58 0.15
59 0.16
60 0.17
61 0.18
62 0.22
63 0.24
64 0.23
65 0.2
66 0.19
67 0.16
68 0.15
69 0.14
70 0.09
71 0.08
72 0.09
73 0.08
74 0.08
75 0.08
76 0.08
77 0.08