Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3F3PND1

Protein Details
Accession A0A3F3PND1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
56-75LPRNSYHHHHHPHHHPHPQHBasic
NLS Segment(s)
Subcellular Location(s) extr 17, mito 7, cyto 1, plas 1, E.R. 1
Family & Domain DBs
Amino Acid Sequences MQVTVFIVLVVASRHIHILVHISKQISINQSIISIPSIIHSRSSYVHHHQSSSLILPRNSYHHHHHPHHHPHPQHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.09
5 0.15
6 0.15
7 0.17
8 0.19
9 0.19
10 0.2
11 0.22
12 0.24
13 0.2
14 0.19
15 0.18
16 0.16
17 0.15
18 0.14
19 0.13
20 0.1
21 0.08
22 0.06
23 0.07
24 0.08
25 0.08
26 0.09
27 0.09
28 0.1
29 0.11
30 0.15
31 0.19
32 0.23
33 0.31
34 0.31
35 0.31
36 0.3
37 0.3
38 0.29
39 0.27
40 0.26
41 0.22
42 0.22
43 0.23
44 0.24
45 0.28
46 0.3
47 0.32
48 0.35
49 0.41
50 0.5
51 0.55
52 0.62
53 0.68
54 0.75
55 0.79
56 0.8