Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3F3Q2K4

Protein Details
Accession A0A3F3Q2K4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
40-62VPAARAKCTRRVPKDRTERQPGYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, mito_nucl 13
Family & Domain DBs
Amino Acid Sequences MKTSSMYVRMFKLVHHVRSMKALPRQGLSPLFGVVSGVQVPAARAKCTRRVPKDRTERQPGYPSFRCKVGADD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.39
3 0.39
4 0.36
5 0.41
6 0.44
7 0.4
8 0.39
9 0.4
10 0.35
11 0.35
12 0.35
13 0.32
14 0.3
15 0.25
16 0.19
17 0.16
18 0.14
19 0.12
20 0.11
21 0.08
22 0.07
23 0.05
24 0.04
25 0.04
26 0.04
27 0.05
28 0.09
29 0.1
30 0.11
31 0.14
32 0.18
33 0.26
34 0.36
35 0.46
36 0.51
37 0.6
38 0.66
39 0.73
40 0.81
41 0.82
42 0.82
43 0.82
44 0.76
45 0.73
46 0.76
47 0.7
48 0.68
49 0.66
50 0.63
51 0.56
52 0.55
53 0.51