Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8MW25

Protein Details
Accession B8MW25    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
188-220IRGMSRAERKERIRRNERKMRNNERKSRKSGGGBasic
NLS Segment(s)
PositionSequence
102-140PLPTPKPPTKWELFARKKGIGRFSGKAGAGLAEKERRKK
184-220KGSSIRGMSRAERKERIRRNERKMRNNERKSRKSGGG
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MSETATTTAASAASKSKPERLPITVSKPTPYTFDLGHLLANDPNPLEISRSEPVNVSLKATARDGVQSLLNQLLTTCPITSSQQGVLLTLPAPTTVLPRHKPLPTPKPPTKWELFARKKGIGRFSGKAGAGLAEKERRKKLVYDEEKGEWVPRWGYKGKNKSDEDWLVEVNEKDWKKEEEAAAKGSSIRGMSRAERKERIRRNERKMRNNERKSRKSGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.32
4 0.35
5 0.42
6 0.46
7 0.46
8 0.51
9 0.52
10 0.58
11 0.57
12 0.55
13 0.52
14 0.49
15 0.45
16 0.41
17 0.36
18 0.3
19 0.22
20 0.24
21 0.24
22 0.22
23 0.22
24 0.18
25 0.18
26 0.17
27 0.17
28 0.14
29 0.11
30 0.11
31 0.11
32 0.11
33 0.11
34 0.1
35 0.15
36 0.16
37 0.17
38 0.17
39 0.17
40 0.2
41 0.23
42 0.23
43 0.19
44 0.2
45 0.2
46 0.21
47 0.21
48 0.2
49 0.15
50 0.16
51 0.14
52 0.13
53 0.13
54 0.12
55 0.12
56 0.12
57 0.11
58 0.1
59 0.09
60 0.08
61 0.08
62 0.09
63 0.08
64 0.07
65 0.09
66 0.1
67 0.12
68 0.13
69 0.12
70 0.15
71 0.15
72 0.14
73 0.13
74 0.12
75 0.1
76 0.09
77 0.08
78 0.05
79 0.05
80 0.05
81 0.07
82 0.1
83 0.16
84 0.18
85 0.21
86 0.26
87 0.27
88 0.33
89 0.39
90 0.46
91 0.49
92 0.57
93 0.59
94 0.61
95 0.62
96 0.62
97 0.56
98 0.51
99 0.48
100 0.5
101 0.5
102 0.51
103 0.52
104 0.51
105 0.52
106 0.49
107 0.47
108 0.42
109 0.4
110 0.35
111 0.33
112 0.33
113 0.29
114 0.27
115 0.22
116 0.18
117 0.13
118 0.13
119 0.13
120 0.16
121 0.19
122 0.24
123 0.26
124 0.28
125 0.29
126 0.32
127 0.38
128 0.42
129 0.47
130 0.46
131 0.48
132 0.47
133 0.47
134 0.44
135 0.37
136 0.26
137 0.21
138 0.18
139 0.15
140 0.18
141 0.21
142 0.28
143 0.36
144 0.45
145 0.51
146 0.58
147 0.59
148 0.57
149 0.62
150 0.58
151 0.53
152 0.46
153 0.38
154 0.3
155 0.3
156 0.27
157 0.2
158 0.23
159 0.19
160 0.19
161 0.22
162 0.24
163 0.24
164 0.3
165 0.34
166 0.34
167 0.36
168 0.38
169 0.35
170 0.33
171 0.3
172 0.25
173 0.22
174 0.16
175 0.13
176 0.13
177 0.16
178 0.22
179 0.3
180 0.38
181 0.43
182 0.51
183 0.59
184 0.67
185 0.73
186 0.78
187 0.8
188 0.82
189 0.86
190 0.89
191 0.9
192 0.91
193 0.92
194 0.92
195 0.93
196 0.93
197 0.93
198 0.93
199 0.92
200 0.89