Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8NYT8

Protein Details
Accession B8NYT8    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
123-143LKLATLRRRRSTQERKHFYCAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029032  AhpD-like  
IPR003779  CMD-like  
Gene Ontology GO:0051920  F:peroxiredoxin activity  
Pfam View protein in Pfam  
PF02627  CMD  
Amino Acid Sequences MARFPTISAEERTPTTDFIEQGIRRQTFSKSAFIAGWEDASGTILGPYAALPHDSPSLSPSLDKRELAVLAVMTEYDAPYVLYAHSEIALAAGLSREQIQQAVDGMVPDGLDEQEAMVYSLVLKLATLRRRRSTQERKHFYCA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.24
4 0.22
5 0.21
6 0.29
7 0.26
8 0.3
9 0.37
10 0.34
11 0.32
12 0.34
13 0.34
14 0.34
15 0.36
16 0.36
17 0.28
18 0.3
19 0.28
20 0.28
21 0.27
22 0.19
23 0.16
24 0.12
25 0.1
26 0.08
27 0.09
28 0.08
29 0.05
30 0.05
31 0.05
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.05
38 0.06
39 0.07
40 0.09
41 0.09
42 0.09
43 0.1
44 0.11
45 0.1
46 0.11
47 0.11
48 0.16
49 0.18
50 0.18
51 0.18
52 0.18
53 0.18
54 0.17
55 0.15
56 0.08
57 0.06
58 0.06
59 0.05
60 0.04
61 0.04
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.04
68 0.04
69 0.04
70 0.04
71 0.05
72 0.05
73 0.05
74 0.05
75 0.04
76 0.04
77 0.04
78 0.03
79 0.03
80 0.03
81 0.04
82 0.05
83 0.05
84 0.05
85 0.06
86 0.07
87 0.07
88 0.08
89 0.08
90 0.07
91 0.07
92 0.07
93 0.06
94 0.06
95 0.05
96 0.05
97 0.05
98 0.05
99 0.04
100 0.04
101 0.04
102 0.05
103 0.06
104 0.05
105 0.05
106 0.05
107 0.06
108 0.06
109 0.05
110 0.05
111 0.09
112 0.16
113 0.25
114 0.33
115 0.4
116 0.47
117 0.53
118 0.62
119 0.69
120 0.73
121 0.76
122 0.79
123 0.82