Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3F3QK51

Protein Details
Accession A0A3F3QK51    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
52-76YFYLRSQKPRRNECKQTSKRKGYILHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 11, mito 6, E.R. 4, extr 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDDGSHAIYLSMVDECLCFVCDLSVTTVEGCMNLFSHAIPLSLSLPCFYTMYFYLRSQKPRRNECKQTSKRKGYILVAYLNFFSFFFLFSFSLRVLVSGVSLGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.08
5 0.07
6 0.06
7 0.07
8 0.07
9 0.08
10 0.1
11 0.1
12 0.1
13 0.1
14 0.1
15 0.1
16 0.09
17 0.08
18 0.07
19 0.06
20 0.06
21 0.06
22 0.06
23 0.07
24 0.07
25 0.07
26 0.07
27 0.07
28 0.08
29 0.08
30 0.08
31 0.07
32 0.08
33 0.09
34 0.09
35 0.08
36 0.09
37 0.09
38 0.12
39 0.14
40 0.14
41 0.2
42 0.24
43 0.32
44 0.37
45 0.43
46 0.49
47 0.58
48 0.66
49 0.68
50 0.75
51 0.76
52 0.8
53 0.83
54 0.86
55 0.86
56 0.85
57 0.8
58 0.74
59 0.7
60 0.63
61 0.59
62 0.5
63 0.45
64 0.38
65 0.34
66 0.3
67 0.26
68 0.22
69 0.16
70 0.15
71 0.09
72 0.09
73 0.08
74 0.11
75 0.12
76 0.12
77 0.14
78 0.12
79 0.14
80 0.13
81 0.13
82 0.1
83 0.1
84 0.09