Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3F3Q638

Protein Details
Accession A0A3F3Q638    Localization Confidence High Confidence Score 22.4
NoLS Segment(s)
PositionSequenceProtein Nature
677-703AESPGSKPEKRKYTKRKKPDGTPMDFPBasic
719-744EEFIKAPPVKKRKPSRSPSPNYPPESHydrophilic
828-852RPGASVEKEKKRRPSPPPPASQPPSHydrophilic
NLS Segment(s)
PositionSequence
610-695RRRGPGRPPKDGIMSKRERAELAREQKLAAKREANGGVTPPPMNRPKAGKAPAPTSGATAAPKESVGAESPGSKPEKRKYTKRKKP
725-734PPVKKRKPSR
835-843KEKKRRPSP
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000253  FHA_dom  
IPR045178  Fhl1/FHA1  
IPR001766  Fork_head_dom  
IPR008984  SMAD_FHA_dom_sf  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
GO:0045892  P:negative regulation of DNA-templated transcription  
GO:0045893  P:positive regulation of DNA-templated transcription  
GO:0060962  P:regulation of ribosomal protein gene transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00498  FHA  
PF00250  Forkhead  
PROSITE View protein in PROSITE  
PS50006  FHA_DOMAIN  
PS50039  FORK_HEAD_3  
Amino Acid Sequences MSSSQTMTASAVGHRPPDAAPNMSSVYDYARSQQQHDDQPHPSPPSDSAIRPLHDSAPDSPPNGLSTLSSTTPVVKSEPGDHDSAPSASAPPESQSDIRRQSAASALLAQLLGNQVSADGLESEDHPMPPAQDGAEPPQNNDQDVKSQWQFESTSEPPAAPADSTNGGADQFPPESTESLAPHQQDGKISEQPPDIPFSNPDHGDSMSIKASEAVEGLTDPLLFSKSSLDHPDLFSSFDITAAPKTPFEALQQNEMLTAAYLSQSADLSALGYSGGHLSHDIAGSVAGSEPRIQAFAKLEFDDGHFYCNTYSFILGRDVRAARAAHQREIQVRQAMRTSRAKSSSGGNTSHTPNRVKHEGSGILGSVVSDRGGIMGFDPDIPPHLPHHLSRRSSVSSHAESAPLHATPAQLQSTTDYNALAMQSLNEENGDAKPVDALALLPSPDACPTIPIHPPATVDGSAAGHRGISRKHVKIAYNFDRNLFEMEVMGRNGAFIGADWLSPGQVRPLHSGDYIQIGGVRIRFLLPDVPIGETGADREEEPFTAEDEKAQASTTAENETPAPKRASDGSETKETPKTTKIILKTRAEPDPSRPVQSVEGSGDPNQQPVRRRGPGRPPKDGIMSKRERAELAREQKLAAKREANGGVTPPPMNRPKAGKAPAPTSGATAAPKESVGAESPGSKPEKRKYTKRKKPDGTPMDFPLPSTEGGQFPMEHRPEEFIKAPPVKKRKPSRSPSPNYPPESAYTPEDLAKPPYNYAVLIFDALTEAGTPMTLKQIYRALKLKYPYFRFKCETEGWTSSVRHNLNGNSHLFMHAERDGKGWSWQLRPGASVEKEKKRRPSPPPPASQPPSAPSATPQYMPQLNPSYGNQHGQPGMANPHFQFPSMPPNPYAPPPPPAPAPNPTPAPHHSSPYPPPAPAAASTPFPIPSPLRNNLPPAFAQTTPSTYTSPYASDPPPQLVQLQQSQQTQPMLPQPQHQSPYPPPNPPSMPPMNAPPHQGHHPPPPPPGPPMQHPPPNMGMGHDPGPGPMDNSEASSFNERASKAIDDFEAVLMEDYEDKNYIREVLKSARARVLGNATDSSFPGGEPKDEAVILDALRNLIGSLKDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.2
4 0.26
5 0.28
6 0.27
7 0.26
8 0.28
9 0.29
10 0.28
11 0.28
12 0.21
13 0.21
14 0.21
15 0.21
16 0.21
17 0.26
18 0.28
19 0.31
20 0.39
21 0.42
22 0.48
23 0.54
24 0.56
25 0.53
26 0.56
27 0.6
28 0.55
29 0.49
30 0.42
31 0.39
32 0.39
33 0.39
34 0.35
35 0.36
36 0.39
37 0.39
38 0.4
39 0.4
40 0.37
41 0.36
42 0.38
43 0.34
44 0.37
45 0.38
46 0.35
47 0.34
48 0.31
49 0.29
50 0.27
51 0.23
52 0.16
53 0.16
54 0.19
55 0.18
56 0.19
57 0.18
58 0.21
59 0.21
60 0.22
61 0.21
62 0.19
63 0.21
64 0.26
65 0.32
66 0.31
67 0.32
68 0.31
69 0.31
70 0.31
71 0.29
72 0.23
73 0.18
74 0.16
75 0.14
76 0.16
77 0.14
78 0.14
79 0.16
80 0.19
81 0.23
82 0.25
83 0.33
84 0.38
85 0.4
86 0.39
87 0.37
88 0.35
89 0.36
90 0.34
91 0.26
92 0.22
93 0.2
94 0.19
95 0.19
96 0.16
97 0.12
98 0.12
99 0.1
100 0.08
101 0.08
102 0.07
103 0.07
104 0.07
105 0.06
106 0.05
107 0.06
108 0.06
109 0.07
110 0.12
111 0.13
112 0.14
113 0.14
114 0.15
115 0.15
116 0.16
117 0.16
118 0.13
119 0.14
120 0.16
121 0.21
122 0.29
123 0.28
124 0.3
125 0.37
126 0.37
127 0.35
128 0.36
129 0.31
130 0.28
131 0.31
132 0.35
133 0.3
134 0.32
135 0.31
136 0.32
137 0.31
138 0.27
139 0.32
140 0.26
141 0.29
142 0.26
143 0.26
144 0.23
145 0.23
146 0.23
147 0.15
148 0.15
149 0.13
150 0.14
151 0.15
152 0.15
153 0.14
154 0.13
155 0.13
156 0.13
157 0.12
158 0.11
159 0.11
160 0.12
161 0.13
162 0.14
163 0.15
164 0.18
165 0.17
166 0.2
167 0.25
168 0.24
169 0.25
170 0.27
171 0.27
172 0.27
173 0.28
174 0.29
175 0.32
176 0.32
177 0.33
178 0.32
179 0.34
180 0.32
181 0.33
182 0.3
183 0.24
184 0.27
185 0.28
186 0.32
187 0.3
188 0.3
189 0.27
190 0.26
191 0.27
192 0.25
193 0.22
194 0.18
195 0.17
196 0.16
197 0.15
198 0.15
199 0.13
200 0.12
201 0.09
202 0.07
203 0.07
204 0.08
205 0.07
206 0.06
207 0.06
208 0.06
209 0.07
210 0.07
211 0.07
212 0.09
213 0.11
214 0.15
215 0.19
216 0.22
217 0.23
218 0.25
219 0.28
220 0.25
221 0.25
222 0.21
223 0.2
224 0.16
225 0.14
226 0.13
227 0.11
228 0.12
229 0.13
230 0.14
231 0.12
232 0.13
233 0.14
234 0.15
235 0.17
236 0.23
237 0.22
238 0.26
239 0.27
240 0.26
241 0.24
242 0.23
243 0.2
244 0.12
245 0.1
246 0.06
247 0.05
248 0.05
249 0.05
250 0.06
251 0.06
252 0.06
253 0.06
254 0.05
255 0.06
256 0.05
257 0.05
258 0.04
259 0.04
260 0.04
261 0.05
262 0.05
263 0.05
264 0.05
265 0.06
266 0.08
267 0.08
268 0.07
269 0.07
270 0.07
271 0.06
272 0.06
273 0.06
274 0.05
275 0.06
276 0.07
277 0.07
278 0.08
279 0.09
280 0.09
281 0.11
282 0.14
283 0.17
284 0.18
285 0.18
286 0.19
287 0.18
288 0.19
289 0.22
290 0.19
291 0.18
292 0.15
293 0.15
294 0.15
295 0.15
296 0.15
297 0.11
298 0.12
299 0.1
300 0.11
301 0.17
302 0.17
303 0.16
304 0.21
305 0.21
306 0.2
307 0.24
308 0.22
309 0.21
310 0.31
311 0.33
312 0.31
313 0.33
314 0.36
315 0.37
316 0.41
317 0.41
318 0.37
319 0.35
320 0.33
321 0.35
322 0.34
323 0.35
324 0.38
325 0.37
326 0.37
327 0.4
328 0.4
329 0.36
330 0.4
331 0.41
332 0.37
333 0.35
334 0.32
335 0.32
336 0.35
337 0.38
338 0.37
339 0.34
340 0.33
341 0.38
342 0.4
343 0.38
344 0.35
345 0.36
346 0.33
347 0.31
348 0.28
349 0.21
350 0.16
351 0.15
352 0.13
353 0.08
354 0.06
355 0.05
356 0.04
357 0.04
358 0.04
359 0.04
360 0.04
361 0.04
362 0.05
363 0.05
364 0.06
365 0.06
366 0.06
367 0.08
368 0.09
369 0.1
370 0.1
371 0.14
372 0.16
373 0.18
374 0.27
375 0.33
376 0.34
377 0.35
378 0.39
379 0.38
380 0.37
381 0.39
382 0.36
383 0.31
384 0.32
385 0.29
386 0.26
387 0.23
388 0.24
389 0.21
390 0.15
391 0.13
392 0.11
393 0.1
394 0.1
395 0.13
396 0.12
397 0.11
398 0.11
399 0.13
400 0.14
401 0.15
402 0.14
403 0.1
404 0.1
405 0.1
406 0.1
407 0.08
408 0.07
409 0.05
410 0.06
411 0.07
412 0.07
413 0.06
414 0.06
415 0.07
416 0.07
417 0.08
418 0.07
419 0.06
420 0.06
421 0.06
422 0.06
423 0.05
424 0.05
425 0.05
426 0.05
427 0.06
428 0.05
429 0.06
430 0.06
431 0.06
432 0.07
433 0.06
434 0.07
435 0.08
436 0.12
437 0.14
438 0.16
439 0.17
440 0.17
441 0.18
442 0.17
443 0.19
444 0.15
445 0.13
446 0.12
447 0.11
448 0.11
449 0.1
450 0.09
451 0.06
452 0.07
453 0.09
454 0.09
455 0.16
456 0.23
457 0.24
458 0.29
459 0.34
460 0.36
461 0.4
462 0.49
463 0.49
464 0.49
465 0.48
466 0.44
467 0.41
468 0.38
469 0.35
470 0.25
471 0.17
472 0.1
473 0.11
474 0.11
475 0.1
476 0.09
477 0.07
478 0.06
479 0.06
480 0.06
481 0.04
482 0.03
483 0.05
484 0.05
485 0.05
486 0.05
487 0.05
488 0.06
489 0.06
490 0.06
491 0.07
492 0.09
493 0.11
494 0.14
495 0.16
496 0.17
497 0.17
498 0.18
499 0.15
500 0.15
501 0.13
502 0.1
503 0.09
504 0.08
505 0.09
506 0.09
507 0.08
508 0.06
509 0.06
510 0.06
511 0.06
512 0.08
513 0.07
514 0.09
515 0.09
516 0.1
517 0.1
518 0.1
519 0.09
520 0.07
521 0.07
522 0.06
523 0.06
524 0.05
525 0.06
526 0.07
527 0.06
528 0.08
529 0.08
530 0.08
531 0.09
532 0.09
533 0.08
534 0.09
535 0.09
536 0.08
537 0.08
538 0.07
539 0.06
540 0.07
541 0.08
542 0.09
543 0.08
544 0.09
545 0.09
546 0.12
547 0.13
548 0.15
549 0.15
550 0.13
551 0.14
552 0.16
553 0.17
554 0.18
555 0.21
556 0.22
557 0.25
558 0.26
559 0.28
560 0.3
561 0.28
562 0.26
563 0.24
564 0.22
565 0.21
566 0.25
567 0.28
568 0.32
569 0.39
570 0.41
571 0.43
572 0.46
573 0.46
574 0.45
575 0.4
576 0.38
577 0.4
578 0.38
579 0.35
580 0.32
581 0.3
582 0.28
583 0.28
584 0.24
585 0.16
586 0.16
587 0.15
588 0.15
589 0.18
590 0.16
591 0.18
592 0.18
593 0.19
594 0.22
595 0.27
596 0.34
597 0.35
598 0.38
599 0.43
600 0.52
601 0.59
602 0.61
603 0.62
604 0.58
605 0.54
606 0.58
607 0.55
608 0.48
609 0.47
610 0.46
611 0.42
612 0.42
613 0.4
614 0.34
615 0.31
616 0.34
617 0.33
618 0.36
619 0.37
620 0.35
621 0.35
622 0.39
623 0.42
624 0.39
625 0.34
626 0.29
627 0.25
628 0.3
629 0.31
630 0.27
631 0.22
632 0.2
633 0.19
634 0.18
635 0.18
636 0.13
637 0.17
638 0.2
639 0.21
640 0.23
641 0.26
642 0.29
643 0.37
644 0.4
645 0.39
646 0.38
647 0.4
648 0.41
649 0.39
650 0.34
651 0.27
652 0.24
653 0.21
654 0.18
655 0.16
656 0.12
657 0.1
658 0.09
659 0.09
660 0.08
661 0.08
662 0.08
663 0.08
664 0.08
665 0.1
666 0.11
667 0.15
668 0.18
669 0.19
670 0.25
671 0.31
672 0.41
673 0.47
674 0.57
675 0.64
676 0.73
677 0.81
678 0.85
679 0.89
680 0.86
681 0.88
682 0.88
683 0.87
684 0.81
685 0.75
686 0.68
687 0.61
688 0.53
689 0.44
690 0.35
691 0.27
692 0.21
693 0.18
694 0.16
695 0.12
696 0.13
697 0.14
698 0.12
699 0.12
700 0.2
701 0.19
702 0.18
703 0.18
704 0.2
705 0.21
706 0.24
707 0.24
708 0.19
709 0.25
710 0.31
711 0.35
712 0.4
713 0.48
714 0.51
715 0.59
716 0.68
717 0.71
718 0.75
719 0.81
720 0.83
721 0.85
722 0.86
723 0.86
724 0.86
725 0.83
726 0.77
727 0.71
728 0.61
729 0.52
730 0.47
731 0.4
732 0.32
733 0.25
734 0.22
735 0.21
736 0.21
737 0.2
738 0.22
739 0.23
740 0.22
741 0.2
742 0.21
743 0.2
744 0.18
745 0.18
746 0.15
747 0.11
748 0.11
749 0.1
750 0.08
751 0.08
752 0.08
753 0.07
754 0.05
755 0.04
756 0.04
757 0.04
758 0.04
759 0.04
760 0.08
761 0.09
762 0.09
763 0.12
764 0.19
765 0.21
766 0.26
767 0.32
768 0.31
769 0.34
770 0.39
771 0.43
772 0.45
773 0.49
774 0.55
775 0.53
776 0.57
777 0.56
778 0.53
779 0.53
780 0.48
781 0.45
782 0.41
783 0.39
784 0.35
785 0.36
786 0.35
787 0.31
788 0.35
789 0.32
790 0.28
791 0.29
792 0.3
793 0.3
794 0.34
795 0.33
796 0.27
797 0.27
798 0.25
799 0.22
800 0.19
801 0.18
802 0.17
803 0.18
804 0.16
805 0.17
806 0.17
807 0.18
808 0.2
809 0.22
810 0.22
811 0.23
812 0.27
813 0.29
814 0.28
815 0.29
816 0.28
817 0.3
818 0.29
819 0.36
820 0.4
821 0.47
822 0.56
823 0.61
824 0.69
825 0.7
826 0.77
827 0.77
828 0.8
829 0.81
830 0.82
831 0.84
832 0.82
833 0.83
834 0.78
835 0.73
836 0.64
837 0.55
838 0.5
839 0.42
840 0.34
841 0.27
842 0.3
843 0.27
844 0.25
845 0.24
846 0.25
847 0.28
848 0.28
849 0.32
850 0.3
851 0.29
852 0.31
853 0.31
854 0.3
855 0.29
856 0.31
857 0.26
858 0.24
859 0.24
860 0.21
861 0.21
862 0.18
863 0.23
864 0.22
865 0.24
866 0.21
867 0.26
868 0.26
869 0.25
870 0.24
871 0.2
872 0.29
873 0.29
874 0.31
875 0.27
876 0.31
877 0.33
878 0.34
879 0.37
880 0.29
881 0.31
882 0.31
883 0.33
884 0.33
885 0.35
886 0.36
887 0.36
888 0.38
889 0.39
890 0.4
891 0.39
892 0.4
893 0.39
894 0.44
895 0.4
896 0.4
897 0.38
898 0.4
899 0.44
900 0.48
901 0.47
902 0.39
903 0.38
904 0.35
905 0.34
906 0.29
907 0.27
908 0.2
909 0.19
910 0.2
911 0.2
912 0.19
913 0.17
914 0.2
915 0.19
916 0.24
917 0.3
918 0.33
919 0.38
920 0.41
921 0.47
922 0.45
923 0.45
924 0.38
925 0.38
926 0.37
927 0.31
928 0.32
929 0.27
930 0.29
931 0.28
932 0.3
933 0.24
934 0.22
935 0.23
936 0.21
937 0.21
938 0.2
939 0.23
940 0.22
941 0.27
942 0.28
943 0.3
944 0.3
945 0.29
946 0.28
947 0.26
948 0.29
949 0.3
950 0.32
951 0.33
952 0.36
953 0.36
954 0.38
955 0.38
956 0.33
957 0.3
958 0.34
959 0.35
960 0.33
961 0.39
962 0.42
963 0.47
964 0.51
965 0.49
966 0.48
967 0.5
968 0.6
969 0.58
970 0.58
971 0.53
972 0.57
973 0.6
974 0.55
975 0.54
976 0.49
977 0.47
978 0.42
979 0.48
980 0.48
981 0.46
982 0.48
983 0.43
984 0.42
985 0.45
986 0.48
987 0.45
988 0.48
989 0.53
990 0.53
991 0.56
992 0.58
993 0.55
994 0.53
995 0.56
996 0.51
997 0.51
998 0.55
999 0.57
1000 0.59
1001 0.57
1002 0.58
1003 0.53
1004 0.51
1005 0.45
1006 0.38
1007 0.33
1008 0.29
1009 0.29
1010 0.26
1011 0.22
1012 0.19
1013 0.22
1014 0.19
1015 0.17
1016 0.14
1017 0.15
1018 0.14
1019 0.17
1020 0.18
1021 0.17
1022 0.19
1023 0.23
1024 0.23
1025 0.22
1026 0.27
1027 0.24
1028 0.24
1029 0.26
1030 0.26
1031 0.22
1032 0.24
1033 0.23
1034 0.2
1035 0.21
1036 0.2
1037 0.17
1038 0.13
1039 0.12
1040 0.1
1041 0.1
1042 0.11
1043 0.1
1044 0.12
1045 0.13
1046 0.13
1047 0.14
1048 0.14
1049 0.19
1050 0.18
1051 0.2
1052 0.24
1053 0.29
1054 0.38
1055 0.42
1056 0.45
1057 0.46
1058 0.46
1059 0.45
1060 0.45
1061 0.45
1062 0.39
1063 0.37
1064 0.35
1065 0.31
1066 0.3
1067 0.3
1068 0.28
1069 0.2
1070 0.17
1071 0.2
1072 0.19
1073 0.19
1074 0.2
1075 0.21
1076 0.21
1077 0.2
1078 0.21
1079 0.17
1080 0.18
1081 0.17
1082 0.16
1083 0.15
1084 0.13
1085 0.13
1086 0.13
1087 0.1
1088 0.11