Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3F3PNV6

Protein Details
Accession A0A3F3PNV6   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
15-56EEEKEERRSSRRMKRKREAKEKRKRKRKRRREEGRKPAIRGQBasic
NLS Segment(s)
PositionSequence
9-57EGRKGGEEEKEERRSSRRMKRKREAKEKRKRKRKRRREEGRKPAIRGQN
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MDEWNGRGEGRKGGEEEKEERRSSRRMKRKREAKEKRKRKRKRRREEGRKPAIRGQNGKGQQKQDRNSGCLFILFYFILFEQKILSSGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.36
4 0.39
5 0.42
6 0.4
7 0.41
8 0.42
9 0.47
10 0.52
11 0.57
12 0.6
13 0.64
14 0.73
15 0.81
16 0.86
17 0.88
18 0.9
19 0.91
20 0.91
21 0.92
22 0.93
23 0.93
24 0.94
25 0.94
26 0.94
27 0.94
28 0.94
29 0.95
30 0.95
31 0.95
32 0.96
33 0.96
34 0.96
35 0.95
36 0.89
37 0.81
38 0.78
39 0.72
40 0.67
41 0.6
42 0.52
43 0.5
44 0.51
45 0.54
46 0.51
47 0.52
48 0.54
49 0.58
50 0.59
51 0.59
52 0.56
53 0.53
54 0.5
55 0.45
56 0.38
57 0.3
58 0.27
59 0.18
60 0.17
61 0.13
62 0.12
63 0.11
64 0.11
65 0.13
66 0.12
67 0.11
68 0.1
69 0.11