Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3F3Q4C3

Protein Details
Accession A0A3F3Q4C3   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
22-51LPTLCTSKVRVKNKKELKRKRQHGYFNQGEHydrophilic
NLS Segment(s)
PositionSequence
31-42RVKNKKELKRKR
Subcellular Location(s) plas 11, mito 7, E.R. 3, nucl 2.5, cyto_nucl 2.5, cyto 1.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTTCLSGWIWPSCQASGRYYKLPTLCTSKVRVKNKKELKRKRQHGYFNQGELIRRFAFLFPLVFLPPAYLRLVTMAVTSNQQPISARDLVLLGISITLSISLFTVCSDAYLPPISLSTIICSGDSSEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.35
4 0.37
5 0.37
6 0.37
7 0.4
8 0.38
9 0.39
10 0.38
11 0.38
12 0.38
13 0.37
14 0.41
15 0.46
16 0.52
17 0.6
18 0.66
19 0.65
20 0.72
21 0.79
22 0.83
23 0.85
24 0.87
25 0.87
26 0.89
27 0.91
28 0.9
29 0.89
30 0.89
31 0.87
32 0.85
33 0.78
34 0.69
35 0.63
36 0.54
37 0.47
38 0.38
39 0.33
40 0.23
41 0.19
42 0.17
43 0.14
44 0.14
45 0.12
46 0.11
47 0.08
48 0.09
49 0.09
50 0.08
51 0.08
52 0.08
53 0.07
54 0.08
55 0.08
56 0.07
57 0.07
58 0.07
59 0.08
60 0.07
61 0.08
62 0.07
63 0.07
64 0.08
65 0.09
66 0.11
67 0.1
68 0.11
69 0.11
70 0.12
71 0.17
72 0.17
73 0.16
74 0.14
75 0.14
76 0.14
77 0.13
78 0.11
79 0.05
80 0.04
81 0.04
82 0.04
83 0.03
84 0.03
85 0.03
86 0.03
87 0.04
88 0.04
89 0.04
90 0.04
91 0.05
92 0.05
93 0.06
94 0.07
95 0.07
96 0.1
97 0.11
98 0.11
99 0.11
100 0.12
101 0.12
102 0.12
103 0.12
104 0.12
105 0.13
106 0.14
107 0.13
108 0.13