Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3F3Q0M9

Protein Details
Accession A0A3F3Q0M9    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
137-160LTGHDKPSEKPERRKPWEKGIASKBasic
NLS Segment(s)
PositionSequence
146-158KPERRKPWEKGIA
Subcellular Location(s) nucl 16.5, cyto_nucl 13.5, cyto 9.5
Family & Domain DBs
Pfam View protein in Pfam  
PF17733  DUF5572  
Amino Acid Sequences MSELQSSDIELFERLSSYPFGSDREFAVGLSIILGHPESPASEEEINRSDDLTLQAKCFYFSRKEKLTPPLDFSTYKAWLESASTSKSADLSSPGPTVDVPKSQEEPTYPSSFAHIVELITTGQPIPGIQQIPDTVLTGHDKPSEKPERRKPWEKGIASK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.12
4 0.12
5 0.15
6 0.15
7 0.17
8 0.19
9 0.2
10 0.19
11 0.21
12 0.2
13 0.17
14 0.17
15 0.14
16 0.12
17 0.1
18 0.1
19 0.05
20 0.06
21 0.06
22 0.05
23 0.05
24 0.05
25 0.05
26 0.07
27 0.08
28 0.11
29 0.13
30 0.13
31 0.16
32 0.18
33 0.19
34 0.17
35 0.17
36 0.13
37 0.13
38 0.16
39 0.16
40 0.15
41 0.14
42 0.16
43 0.16
44 0.17
45 0.17
46 0.17
47 0.21
48 0.26
49 0.32
50 0.35
51 0.38
52 0.42
53 0.49
54 0.52
55 0.46
56 0.46
57 0.41
58 0.39
59 0.36
60 0.33
61 0.29
62 0.25
63 0.23
64 0.17
65 0.15
66 0.12
67 0.13
68 0.13
69 0.1
70 0.1
71 0.11
72 0.11
73 0.11
74 0.11
75 0.1
76 0.09
77 0.09
78 0.09
79 0.11
80 0.11
81 0.11
82 0.11
83 0.11
84 0.13
85 0.13
86 0.14
87 0.15
88 0.17
89 0.2
90 0.2
91 0.22
92 0.2
93 0.23
94 0.25
95 0.26
96 0.24
97 0.21
98 0.23
99 0.22
100 0.21
101 0.18
102 0.13
103 0.1
104 0.1
105 0.11
106 0.09
107 0.08
108 0.08
109 0.06
110 0.06
111 0.06
112 0.06
113 0.07
114 0.1
115 0.11
116 0.11
117 0.13
118 0.13
119 0.15
120 0.16
121 0.15
122 0.11
123 0.13
124 0.17
125 0.16
126 0.19
127 0.22
128 0.24
129 0.25
130 0.35
131 0.43
132 0.48
133 0.57
134 0.66
135 0.71
136 0.79
137 0.88
138 0.85
139 0.85
140 0.87