Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3F3PZ25

Protein Details
Accession A0A3F3PZ25    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
11-39FGSCHPTRCRPDVKKRKKNNQPTIPTSNLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 8.5, cyto_nucl 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MAGMRQSLPVFGSCHPTRCRPDVKKRKKNNQPTIPTSNLTGRSCHSAVRSSTDNRCPESGDRKVWLSSGASTLTLQFHYGFSPPREEWICWVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.33
3 0.39
4 0.42
5 0.47
6 0.56
7 0.57
8 0.67
9 0.72
10 0.8
11 0.83
12 0.88
13 0.92
14 0.93
15 0.94
16 0.94
17 0.93
18 0.9
19 0.86
20 0.82
21 0.74
22 0.64
23 0.55
24 0.48
25 0.43
26 0.35
27 0.29
28 0.23
29 0.24
30 0.24
31 0.23
32 0.2
33 0.19
34 0.18
35 0.21
36 0.23
37 0.22
38 0.27
39 0.33
40 0.34
41 0.32
42 0.32
43 0.31
44 0.32
45 0.36
46 0.36
47 0.32
48 0.32
49 0.32
50 0.32
51 0.29
52 0.27
53 0.2
54 0.16
55 0.15
56 0.14
57 0.13
58 0.12
59 0.13
60 0.13
61 0.12
62 0.12
63 0.11
64 0.11
65 0.11
66 0.14
67 0.17
68 0.18
69 0.24
70 0.23
71 0.3
72 0.33
73 0.33