Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3F3Q177

Protein Details
Accession A0A3F3Q177   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
43-64ESNTKPTKEKPKKINITKSHSGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 8, cyto 4
Family & Domain DBs
Amino Acid Sequences MRQIQHPSLDQTGVVPGGPQTVTRDTKLKIPASSIDISRPSAESNTKPTKEKPKKINITKSHSGQKSKTAALRLADPHLSVFRMRPVHLVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.1
3 0.08
4 0.09
5 0.09
6 0.09
7 0.12
8 0.18
9 0.21
10 0.22
11 0.26
12 0.25
13 0.31
14 0.37
15 0.36
16 0.31
17 0.3
18 0.3
19 0.31
20 0.32
21 0.26
22 0.22
23 0.21
24 0.21
25 0.19
26 0.17
27 0.14
28 0.14
29 0.16
30 0.15
31 0.21
32 0.27
33 0.28
34 0.3
35 0.34
36 0.44
37 0.51
38 0.58
39 0.6
40 0.64
41 0.72
42 0.79
43 0.84
44 0.81
45 0.8
46 0.78
47 0.74
48 0.73
49 0.68
50 0.64
51 0.56
52 0.55
53 0.51
54 0.48
55 0.46
56 0.41
57 0.39
58 0.35
59 0.38
60 0.33
61 0.33
62 0.3
63 0.26
64 0.25
65 0.23
66 0.23
67 0.19
68 0.18
69 0.22
70 0.24
71 0.25