Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8NWN5

Protein Details
Accession B8NWN5    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-37TLSASERKRMRDRKARKVAREKRDARIKABasic
NLS Segment(s)
PositionSequence
15-36RKRMRDRKARKVAREKRDARIK
Subcellular Location(s) nucl 17, mito 7, cyto 2
Family & Domain DBs
Amino Acid Sequences MESPRTNDTLSASERKRMRDRKARKVAREKRDARIKALEDRVTYCERHHGAVWVQHIMAAMENLQRENQMLRERQERLHAIFSSWEQDETTLQATRSHNQAASQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.47
3 0.55
4 0.58
5 0.64
6 0.66
7 0.74
8 0.78
9 0.86
10 0.87
11 0.87
12 0.9
13 0.89
14 0.88
15 0.89
16 0.82
17 0.81
18 0.82
19 0.73
20 0.67
21 0.64
22 0.57
23 0.53
24 0.54
25 0.48
26 0.38
27 0.38
28 0.37
29 0.32
30 0.3
31 0.23
32 0.24
33 0.22
34 0.22
35 0.2
36 0.19
37 0.18
38 0.21
39 0.22
40 0.16
41 0.14
42 0.14
43 0.13
44 0.11
45 0.09
46 0.06
47 0.06
48 0.07
49 0.07
50 0.07
51 0.07
52 0.07
53 0.08
54 0.09
55 0.12
56 0.16
57 0.19
58 0.23
59 0.29
60 0.31
61 0.32
62 0.38
63 0.37
64 0.35
65 0.37
66 0.34
67 0.29
68 0.29
69 0.28
70 0.25
71 0.22
72 0.2
73 0.14
74 0.15
75 0.15
76 0.15
77 0.17
78 0.15
79 0.15
80 0.2
81 0.23
82 0.26
83 0.29
84 0.31