Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3F3PH43

Protein Details
Accession A0A3F3PH43    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
74-99LEAGKYARIKQKKKPTTRLIPLNSEQHydrophilic
NLS Segment(s)
PositionSequence
85-86KK
Subcellular Location(s) nucl 19, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MTEIFCLEHTVPASILPGDIQRFSTPTWRFDPFVLALSIHRVIRKVTFDSSLPRKRSVSKTTNSAITRDLCRRLEAGKYARIKQKKKPTTRLIPLNSEQENLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.09
4 0.11
5 0.12
6 0.13
7 0.14
8 0.14
9 0.15
10 0.16
11 0.24
12 0.23
13 0.26
14 0.29
15 0.31
16 0.31
17 0.3
18 0.33
19 0.25
20 0.24
21 0.2
22 0.17
23 0.14
24 0.16
25 0.17
26 0.14
27 0.14
28 0.12
29 0.13
30 0.15
31 0.18
32 0.17
33 0.16
34 0.17
35 0.17
36 0.23
37 0.31
38 0.36
39 0.35
40 0.35
41 0.35
42 0.39
43 0.45
44 0.48
45 0.46
46 0.42
47 0.45
48 0.45
49 0.51
50 0.46
51 0.41
52 0.35
53 0.31
54 0.32
55 0.31
56 0.34
57 0.28
58 0.28
59 0.28
60 0.27
61 0.28
62 0.31
63 0.31
64 0.33
65 0.37
66 0.42
67 0.5
68 0.58
69 0.6
70 0.63
71 0.7
72 0.73
73 0.78
74 0.82
75 0.83
76 0.85
77 0.89
78 0.89
79 0.83
80 0.81
81 0.75
82 0.72
83 0.63