Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3F3QI22

Protein Details
Accession A0A3F3QI22   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MDRFWCLRHSCRKNDFKASHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MDRFWCLRHSCRKNDFKASHRLTRLHWSLGNLAGLQLRGKPLVPAGPVVRCPAVIQVLRSPPLLPKHTHCYPLFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.74
4 0.76
5 0.73
6 0.71
7 0.66
8 0.61
9 0.53
10 0.56
11 0.52
12 0.45
13 0.4
14 0.33
15 0.3
16 0.29
17 0.27
18 0.17
19 0.15
20 0.12
21 0.11
22 0.09
23 0.08
24 0.07
25 0.07
26 0.07
27 0.07
28 0.07
29 0.09
30 0.09
31 0.11
32 0.12
33 0.14
34 0.15
35 0.16
36 0.16
37 0.14
38 0.14
39 0.13
40 0.17
41 0.16
42 0.18
43 0.21
44 0.24
45 0.26
46 0.26
47 0.25
48 0.25
49 0.32
50 0.33
51 0.32
52 0.35
53 0.42
54 0.46
55 0.53