Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3F3QDG3

Protein Details
Accession A0A3F3QDG3    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
45-70VSRIEKNSQKSTKRRRASKKLAALDSHydrophilic
NLS Segment(s)
PositionSequence
34-41KDKRLIKH
46-64SRIEKNSQKSTKRRRASKK
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR028160  Slx9-like  
Gene Ontology GO:0030686  C:90S preribosome  
GO:0005730  C:nucleolus  
GO:0030688  C:preribosome, small subunit precursor  
GO:0000462  P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
Pfam View protein in Pfam  
PF15341  SLX9  
Amino Acid Sequences MAPTRSIKKPASGKGALPSSKPSFLHDEFRTTKKDKRLIKHSSFVSRIEKNSQKSTKRRRASKKLAALDSLADALPDADDAATDPSKQVNIIKQKTLQHRPGAMKRREKLERLERDRFAKNMAQMSSMQAPAPTTTDSNSNTDGGSVSNRWAALRNFISQTMEQQPAFKSSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.6
3 0.53
4 0.47
5 0.46
6 0.42
7 0.44
8 0.42
9 0.38
10 0.37
11 0.38
12 0.45
13 0.39
14 0.43
15 0.43
16 0.46
17 0.49
18 0.45
19 0.49
20 0.49
21 0.56
22 0.56
23 0.61
24 0.67
25 0.71
26 0.73
27 0.74
28 0.7
29 0.69
30 0.63
31 0.59
32 0.55
33 0.49
34 0.46
35 0.46
36 0.47
37 0.44
38 0.51
39 0.55
40 0.57
41 0.64
42 0.72
43 0.74
44 0.77
45 0.82
46 0.83
47 0.86
48 0.88
49 0.87
50 0.85
51 0.82
52 0.75
53 0.65
54 0.55
55 0.45
56 0.34
57 0.25
58 0.16
59 0.08
60 0.06
61 0.05
62 0.04
63 0.04
64 0.03
65 0.02
66 0.02
67 0.03
68 0.05
69 0.05
70 0.05
71 0.06
72 0.06
73 0.06
74 0.07
75 0.08
76 0.12
77 0.21
78 0.24
79 0.26
80 0.3
81 0.36
82 0.44
83 0.5
84 0.5
85 0.44
86 0.48
87 0.52
88 0.57
89 0.61
90 0.6
91 0.61
92 0.58
93 0.63
94 0.62
95 0.58
96 0.59
97 0.59
98 0.62
99 0.61
100 0.66
101 0.61
102 0.61
103 0.61
104 0.53
105 0.47
106 0.4
107 0.35
108 0.33
109 0.3
110 0.27
111 0.24
112 0.27
113 0.26
114 0.23
115 0.19
116 0.14
117 0.14
118 0.13
119 0.15
120 0.13
121 0.11
122 0.11
123 0.16
124 0.18
125 0.21
126 0.22
127 0.2
128 0.19
129 0.18
130 0.18
131 0.14
132 0.15
133 0.13
134 0.12
135 0.14
136 0.14
137 0.15
138 0.2
139 0.2
140 0.24
141 0.26
142 0.29
143 0.29
144 0.31
145 0.34
146 0.29
147 0.34
148 0.32
149 0.34
150 0.3
151 0.3
152 0.31