Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8N332

Protein Details
Accession B8N332    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
206-233ELGTVVRRQKTKRTKKPRLVRTASTTDAHydrophilic
NLS Segment(s)
PositionSequence
213-223RQKTKRTKKPR
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022793  Rrn10  
Gene Ontology GO:0006360  P:transcription by RNA polymerase I  
Amino Acid Sequences MSHGKSLDLSQNSFQPPQDEDDHSEGTSFRRQKRQATVYDAVAGRINAHGFLPLLPFTSRYRDTASSNFRPVRPEEVLFRRQNAPIRYEENDFYFAHESLPSDRPLPSSDLLEAIHAYSADYYDYATPDRGQDDYQSMDETALIAMGILMEEMAKESLGQTGDLVLVEGEEIQSEEDQSHSQTARRVGRKRANTGRSSILASSGDELGTVVRRQKTKRTKKPRLVRTASTTDAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.3
3 0.29
4 0.3
5 0.33
6 0.3
7 0.32
8 0.35
9 0.36
10 0.32
11 0.31
12 0.27
13 0.26
14 0.3
15 0.33
16 0.35
17 0.43
18 0.48
19 0.55
20 0.65
21 0.69
22 0.67
23 0.68
24 0.65
25 0.57
26 0.58
27 0.5
28 0.4
29 0.34
30 0.27
31 0.19
32 0.17
33 0.15
34 0.1
35 0.1
36 0.1
37 0.08
38 0.09
39 0.1
40 0.09
41 0.1
42 0.1
43 0.13
44 0.14
45 0.2
46 0.21
47 0.21
48 0.26
49 0.27
50 0.3
51 0.36
52 0.43
53 0.41
54 0.47
55 0.49
56 0.45
57 0.45
58 0.44
59 0.42
60 0.37
61 0.34
62 0.33
63 0.36
64 0.44
65 0.42
66 0.43
67 0.39
68 0.39
69 0.44
70 0.39
71 0.36
72 0.31
73 0.34
74 0.33
75 0.33
76 0.31
77 0.26
78 0.27
79 0.24
80 0.22
81 0.2
82 0.18
83 0.15
84 0.15
85 0.13
86 0.14
87 0.16
88 0.14
89 0.14
90 0.14
91 0.14
92 0.15
93 0.17
94 0.14
95 0.13
96 0.13
97 0.13
98 0.12
99 0.11
100 0.1
101 0.07
102 0.06
103 0.05
104 0.05
105 0.04
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.05
112 0.06
113 0.07
114 0.07
115 0.08
116 0.09
117 0.09
118 0.09
119 0.1
120 0.11
121 0.12
122 0.12
123 0.12
124 0.11
125 0.1
126 0.09
127 0.08
128 0.06
129 0.05
130 0.04
131 0.03
132 0.03
133 0.02
134 0.02
135 0.02
136 0.02
137 0.02
138 0.02
139 0.03
140 0.03
141 0.03
142 0.03
143 0.04
144 0.06
145 0.07
146 0.07
147 0.06
148 0.07
149 0.07
150 0.07
151 0.07
152 0.04
153 0.04
154 0.04
155 0.04
156 0.03
157 0.03
158 0.03
159 0.04
160 0.04
161 0.05
162 0.05
163 0.06
164 0.07
165 0.08
166 0.11
167 0.12
168 0.14
169 0.17
170 0.25
171 0.33
172 0.41
173 0.46
174 0.53
175 0.61
176 0.68
177 0.74
178 0.77
179 0.76
180 0.71
181 0.69
182 0.64
183 0.57
184 0.51
185 0.41
186 0.34
187 0.26
188 0.23
189 0.21
190 0.16
191 0.14
192 0.11
193 0.11
194 0.09
195 0.11
196 0.13
197 0.17
198 0.22
199 0.29
200 0.33
201 0.44
202 0.54
203 0.63
204 0.72
205 0.77
206 0.83
207 0.88
208 0.95
209 0.95
210 0.94
211 0.91
212 0.88
213 0.85
214 0.81